-
HPA024725-100ULThe gene CRISPLD1 (cysteine rich secretory protein LCCL domain containing 1) is mapped to human chromosome 8q21.11.
-
HPA030054-100UL
Sigma-Aldrich
Anti-CRISPLD2 antibody produced in rabbit (C15-1452-505)
Price: $879.43List Price: $977.14Immunogen Recombinant protein corresponding to cysteine rich secretory protein LCCL domain containing 2 Sequence TRNGKVPFFVKSERHGVQSLSKYKPSSSFMVSKVKVQDLDCYTTVAQLCPFEKPATHCPRIHCPAHCKDEPSYWAPVFGTNIYADTSSICKTAVHAGVISNESGGDVDVMPVDK Application All -
HPA030055-100UL
Sigma-Aldrich
Anti-CRISPLD2 antibody produced in rabbit (C15-1452-506)
Price: $879.43List Price: $977.14Immunogen cysteine-rich secretory protein LCCL domain containing 2 recombinant protein epitope signature tag (PrEST) Application Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given -
HPA068087-100ULImmunogen v-crk avian sarcoma virus CT10 oncogene homolog Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
-
ABC242Crk-like protein (CRKL) is a 39 kDa adaptor protein with one SH2 and two SH3 binding domains. CRKL is the major protein which is tyrosine phosphorylated in response to BCR/ABL (chronic myelogenous leukemia) and growth factor activation.
-
HPA000532-100UL
Sigma-Aldrich
Anti-CRKL antibody produced in rabbit (C15-1444-969)
Price: $879.43List Price: $977.14Immunogen v-crk avian sarcoma virus CT10 oncogene homolog-like Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA001100-100UL
Sigma-Aldrich
Anti-CRKL antibody produced in rabbit (C15-1445-162)
Price: $879.43List Price: $977.14Immunogen Crk-like protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the -
HPA041493-100ULImmunogen cytokine receptor-like factor 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
-
HPA007596-100ULCRLF3 (cytokine receptor-like factor 3) gene is mapped to human chromosome 17q11.2 and is found to be frequently deleted in patients with Neurofibromatosis type 1 (NF1) microdeletions in the neurofibromin locus.
-
HPA024343-100ULImmunogen Cornulin recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most
-
HPA021191-100UL
Sigma-Aldrich
Anti-CROCC antibody produced in rabbit (C15-1449-783)
Price: $879.43List Price: $977.14The gene CROCC (ciliary rootlet coiled-coil protein) is mapped to human chromosome 1p36.13. -
HPA021762-100UL
Sigma-Aldrich
Anti-CROCC antibody produced in rabbit (C15-1449-983)
Price: $879.43List Price: $977.14The gene CROCC (ciliary rootlet coiled-coil protein) encodes a major structural component (Rootletin) of the ciliary rootlet. The gene is mapped to human chromosome 1p36.