Immunology

Immunogen 0000313|Ensembl Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Immunogen Cartilage acidic protein 1 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen CREB-regulated transcription coactivator 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen CREB regulated transcription coactivator 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen CREB regulated transcription coactivator 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

CREB-regulated transcription co-activator 2 (CRTC2) is also known as TORC&nbsp(transducer of regulated CREB). Immunogen CREB regulated transcription coactivator 2 recombinant protein epitope signature tag (PrEST) Application All Prestige

Immunogen CREB regulated transcription coactivator 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen CREB regulated transcription coactivator 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen peptide corresponding to the human CRTH2 (GRP44) protein, near the C-terminus (amino acids 329-348). Application Anti-CRTH2 (GRP44) antibody produced in rabbit is suitable for western blotting at a working dilution of 1:500-1:1,000 using

Immunogen cryptochrome circadian clock 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen Recombinant protein corresponding to crystallin beta B1 Sequence TTVPITSAKAAELPPGNYRLVVFELENFQGRRAEFSGECSNLADRGFDRVRSIIVSAGPWVAFEQSNFRGEMFILEKGEYPRWNTWSSSYRSDRLMSFRPIKMDAQE Application All Prestige Antibodies Powered by Atlas Antibodies

Immunogen crystallin, beta B2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by