-
HPA051194-100ULImmunogen cytochrome P450, family 19, subfamily A, polypeptide 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most
-
HPA055872-100UL
Sigma-Aldrich
Anti-CYP20A1 antibody produced in rabbit (C15-1462-158)
Price: $928.29List Price: $1,031.43Immunogen cytochrome P450, family 20, subfamily A, polypeptide 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA058461-100UL
Sigma-Aldrich
Anti-CYP20A1 antibody produced in rabbit (C15-1462-956)
Price: $928.29List Price: $1,031.43Immunogen cytochrome P450, family 20, subfamily A, polypeptide 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA048979-100UL
Sigma-Aldrich
Anti-CYP21A2 antibody produced in rabbit (C15-1459-775)
Price: $928.29List Price: $1,031.43Immunogen cytochrome P450, family 21, subfamily A, polypeptide 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
HPA053371-100UL
Sigma-Aldrich
Anti-CYP21A2 antibody produced in rabbit (C15-1461-319)
Price: $928.29List Price: $1,031.43Immunogen cytochrome P450, family 21, subfamily A, polypeptide 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
ABN201Also known as Vitamin D(3) 24-hydroxylase, CYP24A1 is a member of the cytochrome P450 (CYP) family of enzymes. Most members of the CYP family can metabolize multiple substrates, and can catalyze multiple reactions.
-
HPA022261-100UL
Sigma-Aldrich
Anti-CYP24A1 antibody produced in rabbit (C15-1450-098)
Price: $879.43List Price: $977.14Immunogen 1,25-dihydroxyvitamin D recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA063771-100UL
Sigma-Aldrich
Anti-CYP24A1 antibody produced in rabbit (C15-1464-482)
Price: $928.29List Price: $1,031.43Immunogen cytochrome P450, family 24, subfamily A, polypeptide 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA012567-100ULImmunogen Cytochrome P450 26B1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by
-
HPA059155-100ULImmunogen cytochrome P450, family 27, subfamily A, polypeptide 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most
-
ABN18225-hydroxyvitamin D-1 alpha hydroxylase (1αOHase VD3 1A hydroxylase 25-OHD-1 alpha-hydroxylase 25-hydroxyvitamin D(3) 1-alpha-hydroxylase or CYP27B1) is a mitochondrial enzyme that belongs to the cytochrome P450 family. It catalyzes the
-
HPA062460-100UL
Sigma-Aldrich
Anti-CYP27C1 antibody produced in rabbit (C15-1464-085)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to cytochrome P450 family 27 subfamily C member 1 Sequence TTSFTLSWTVYLLARHPEVQQTVYREIVKNLGERHVPTAADVPKVPLVRALLK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated