-
HPA069248-100UL
Sigma-Aldrich
Anti-CYP2S1 antibody produced in rabbit (C15-1465-634)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to cytochrome P450 family 2 subfamily S member 1 Sequence GTVAMLEGTFDGHGVFFSNGERWRQLRKFTMLALRDLGMGKREGEELIQAEARCLVETFQGTEGRPFDPSLLLAQATSNVVCSLL Application All Prestige Antibodies Powered by Atlas -
HPA041622-100UL
Sigma-Aldrich
Anti-CYP2U1 antibody produced in rabbit (C15-1456-797)
Price: $928.29List Price: $1,031.43Immunogen cytochrome P450, family 2, subfamily U, polypeptide 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
HPA046754-100UL
Sigma-Aldrich
Anti-CYP2U1 antibody produced in rabbit (C15-1458-978)
Price: $928.29List Price: $1,031.43Immunogen cytochrome P450, family 2, subfamily U, polypeptide 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
HPA064827-100UL
Sigma-Aldrich
Anti-CYP2U1 antibody produced in rabbit (C15-1464-744)
Price: $928.29List Price: $1,031.43Immunogen cytochrome P450, family 2, subfamily U, polypeptide 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA012753-100ULCytochrome P450 2W1 (CYP2W1) is a hemoprotein which belongs to the cytochrome family of proteins. It is located on the cell surface.
-
HPA066463-100ULImmunogen cytochrome P450, family 3, subfamily A, polypeptide 43 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most
-
HPA075539-100ULImmunogen cytochrome P450 family 3 subfamily A member 7 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
-
AB10088Immunogen Recombinant CYP450 1A1 Application Research Category Metabolism Research Sub Category Enzymes & Biochemistry This Anti-CYP450 1A1 Antibody is validated for use in WB for the detection of CYP450 1A1. Quality Routinely evaluated by
-
AV41861-100ULImmunogen Synthetic peptide directed towards the N terminal region of human CYP4A22 Biochem/physiol Actions CYP4A22 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many
-
HPA004331-100ULCYP4B1 (cytochrome P450, family 4, subfamily B, polypeptide 1) is a member of extra-hepatic CYP450 family highly expressed in the lung. More specifically it is observed in the ciliated sub-mucosal gland ducts as well as in the surface epithelium.
-
HPA017265-100ULCYP4F11 (cytochrome P450, family 4, subfamily F, polypeptide 11) is a cytochrome P450 4F isoform belonging to the CYP4 family and CYP4A subfamily. In humans, it is expressed in liver, heart, kidney, and skeletal muscles.
-
HPA014048-100UL
Sigma-Aldrich
Anti-CYP4F2 antibody produced in rabbit (C15-1448-063)
Price: $879.43List Price: $977.14The gene CYP4F2 (cytochrome P450 family 4 subfamily F member 2) encodes a protein belonging to the P450 superfamily of enzymes. The gene is mapped to human chromosome 19p13.