-
HPA050930-100ULImmunogen cysteine-rich transmembrane module containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as
-
AV50256-100ULMitochondrially encoded cytochrome b (MT-CYB CYTB) is encoded by mitochondrial DNA. Immunogen Synthetic peptide directed towards the N terminal region of human CYTB Application Anti-CYTB antibody produced in rabbit is suitable for western blotting
-
HPA060662-100ULImmunogen Recombinant protein corresponding to cytohesin 2 Sequence REELSEAMSEVEGLEANEGSKTLQRNRKMAMGRKKF Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a
-
HPA071573-100ULImmunogen cytohesin 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The
-
HPA067201-100ULImmunogen Recombinant protein corresponding to cytokine like 1 Sequence TCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVAS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas
-
AB1254
Sigma-Aldrich
Anti-Cytochrome P450 Enzyme CYP3A4 Antibody (C15-1315-693)
Price: $804.00List Price: $893.33Specificity The rabbit polyclonal serum detects CYP3A4 in humans and rats by sequence homology of the immunogen used, cross reactivity to CYP3A7, 3A6v43A2v1, 3A8, 3A9 may be expected but is untested at this time. Immunogen A synthetic peptide -
CBL266Specificity This antibody reacts with the suprabasal cells of stratified squamous epithelia in human, murine and porcine species. Immunogen Keratin 1 and 10.
-
CBL197
Sigma-Aldrich
Anti-Cytokeratin 14 Antibody, clone LL002 (C15-1347-237)
Price: $642.86List Price: $714.29Application Anti-Cytokeratin 14 Antibody, clone LL002 is an antibody against Cytokeratin 14 for use in WB, IH(P). Suitable for staining formalin fixed wax sections or frozen tissues. -
CBL197-25UG
Sigma-Aldrich
Anti-Cytokeratin 14 Antibody, clone LL002 (C15-1347-238)
Price: $323.27List Price: $359.18Application Anti-Cytokeratin 14 Antibody, clone LL002 is an antibody against Cytokeratin 14 for use in WB, IH(P). Suitable for staining formalin fixed wax sections or frozen tissues. -
CBL197F
Sigma-Aldrich
Anti-Cytokeratin 14 Antibody, clone LL002, FITC conjugated
Price: $800.57List Price: $889.52Specificity Cytokeratin 14, a type I intermediate filament, is one of the two cytokeratins that distinguish stratifying epithelial cell types from simple epithelial cell types. Thus, cytokeratin 14 is expressed by stratifying/keratinocyte cell -
CBL198Specificity The antibody is specific to human cytokeratin 19 and is reactive with cells of epithelial origin. Cytokeratin 19 is the smallest human cytokeratin (40 kDa) and is found in many simple and invariably in some non-keratinising stratified
-
CBL208IT-Ks 20.8 represents an excellent marker for certain types of carcinomas such as adenocarcinomas of the colon, transitional cell carcinomas of the bladder and Merkel cell tumors of the skin.