Immunology

DIS3-like protein (DIS3L) is encoded by the gene mapped to human chromosome 15q22.31.

Disrupted in schizophrenia 1 (DISC1) is a candidate gene for susceptibility to schizophrenia. It was discovered through chromosomal analysis of a large Scottish family whose members exhibited schizophrenia and related psychiatric disorders.

Disrupted in schizophrenia 1 protein (DISC1) is involved in the regulation of multiple aspects of embryonic and adult neurogenesis. DISC1 may play a role as a modulator of the AKT-mTOR signaling pathway controlling the tempo of the process of

Disrupted in schizophrenia 1 protein (DISC1) is involved in the regulation of multiple aspects of embryonic and adult neurogenesis. DISC1 may play a role as a modulator of the AKT-mTOR signaling pathway controlling the tempo of the process of

Immunogen Recombinant protein corresponding to disrupted in schizophrenia 1 Sequence LQARMFVLEAKDQQLRREIEEQEQQLQWQGCDLTPLVGQLSLGQLQEVSKALQDTLASAGQIPFHAEPPETIRSLQERIKSLNLSLKEITTKVCMSEKFCSTLRKKVNDIET Application All Prestige Antibodies Powered by

DVL1, the human homolog of the Drosophila dishevelled gene (dsh) encodes a cytoplasmic phosphoprotein that regulates cell proliferation. The protein acts as a transducer molecule for developmental processes, including segmentation and neuroblast

Immunogen dispatched homolog 1 (Drosophila) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Dyskeratosis congenita 1 (DKC1) gene encodes dyskerin, which is a 514-amino-acid protein. This gene consists of 15 exons comprising a region of 15kb, with the internal exons size range of 65-185bp.

Immunogen H/ACA ribonucleoprotein complex subunit 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen dyskeratosis congenita 1, dyskerin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen Recombinant protein corresponding to dickkopf WNT signaling pathway inhibitor 2 Sequence MCCPSTRCNNGICIPVTESILTPHIPALDGTRHRDRNHGHYSNHDLGWQNLGRPHTKMSHIKGHEGDPCLRSSDCIEGFCC Application All Prestige Antibodies Powered by Atlas Antibodies are

Immunogen dickkopf-like 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the