Immunology

Immunogen DnaJ (Hsp40) homolog, subfamily A, member 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen DnaJ (Hsp40) homolog, subfamily A, member 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen DnaJ (Hsp40) homolog, subfamily A, member 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen DnaJ (Hsp40) homolog, subfamily B, member 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

DNAJB11 (DnaJ (Hsp40) homolog, subfamily B, member 11) belongs to family of endoplasmic reticulum (ER) Hsp40/DnaJ family. It is a part of ERAD (Endoplasmic-reticulum-associated protein degradation), and is a heat shock protein 40 (HSP40) chaperone.

DNAJB11 (DnaJ (Hsp40) homolog, subfamily B, member 11) is a chaperone of the endoplasmic reticulum belonging to the endoplasmic reticulum (ER) Hsp40/DnaJ family. It is a component of quality control system of ER-associated degradation (ERAD).

DNAJ/HSP40 family of proteins contains a highly conserved, 70 amino acid J domain that is involved in the interaction with HSP70 and regulation of its ATPase activity. It also contains a glycine and phenylalanine (G/F)-rich region that may function

Immunogen DnaJ heat shock protein family (Hsp40) member B12 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen DnaJ (Hsp40) homolog, subfamily B, member 13 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen Recombinant protein corresponding to DnaJ heat shock protein family (Hsp40) member B13 Sequence WTTGYVFHGKPEKVFHEFFGGNNPFSEFFDAEGSEVDLNFGGLQGRGVKKQDPQVERDLYLSLE Application All Prestige Antibodies Powered by Atlas Antibodies are developed

Immunogen DnaJ (Hsp40) homolog, subfamily B, member 14 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen DnaJ (Hsp40) homolog, subfamily B, member 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a