Immunology

Immunogen docking protein 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Immunogen docking protein 6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Immunogen docking protein 6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Immunogen docking protein 7 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Immunogen Recombinant protein corresponding to docking protein 7 Sequence TLQLEKRLSLLSHAGRPGSGGDDRSLSSSSSEASHLDVSASSRLTAWPEQSSSSASTSQE Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Decapping and exoribonuclease protein (DOM3Z), also known as DXO, Dom-3 homolog Z, and encoded by the gene symbol DOM3Z/ DOM3L/ NG6, is a ribonuclease that specifically degrades pre-mRNAs with a defective 5&#8242 end cap. DOM3Z is part of a

Anti-Donkey IgG (H&L) has been assayed against 1.0 ug of Donkey IgG in a standard capture ELISA using Peroxidase Conjugated Streptavidin and ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid]) as a substrate for 30 minutes at room

Anti-Donkey IgG Peroxidase conjugate is suitable for immunoblotting (western or dot blot), ELISA, immunoelectron microscopy and immunohistochemistry as well as other antibody-based enzymatic assays requiring lot-to-lot consistency.

This product is designed for immunofluorescence microscopy, fluorescence based plate assays (FLISA) and fluorescent western blotting. This product is also suitable for multiplex analysis, including multicolor imaging, utilizing various commercial

Anti-Donkey IgG antibody is suitable for ELISA, western blot, and immunohistochemistry, as well as other assays requiring lot-to-lot consistency.

This product has been assayed against 1.0 ug of Donkey IgG in a standard capture ELISA using pNPP (p-nitrophenyl phosphate code # NPP-10) as a substrate for 30 minutes at room temperature.

This product has been assayed against 1.0 &microg of Donkey IgG in a standard capture ELISA using Peroxidase Conjugated Streptavidin #S000-03 and ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid]) code # ABTS-100 as a substrate for 30