Immunology

DSCR1 (Down Syndrome Candidate Region 1 is encoded by a gene mapped to human chromosome 21q22.1.

The gene DSCR3 (Down syndrome critical region protein 3) is mapped to human chromosome 21q22. The gene is present in the locus which participates in the partial or full trisomy of chromosome 21, leading to Down syndrome.

The gene DSCR4 (Down syndrome critical region protein-4) is mapped to human chromosome 21q22.2.

DSG2 (Desmoglein 2) is a transmembrane glycoprotein belonging to the family of Ca(2+) dependent cell adhesion molecules, the cadherins. It is a largest protein of the cadherin family with a molecular weight of 116,760.

Immunogen desmoglein 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen desmoglein 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen Kinetochore-associated protein DSN1 homolog recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen Recombinant protein corresponding to DSN1 homolog, MIS12 kinetochore complex component Sequence LSHQERLQSKSLHLSPQEQSASYQDRRQSWRRASMKETNRRKSLHPIHQGITELSRSISVDLAESKRLGCLLLSSFQFSIQKLEPFLRDTKGFSLESFRAKASSLSEELKHFADGLETDGTLQ Application All

DST gene encodes dystonin, a cytoskeletal linker protein. Dystonin proteins are present as several isoforms in neural and muscle cells.

Immunogen denticleless homolog (Drosophila) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen denticleless E3 ubiquitin protein ligase homolog (Drosophila) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen denticleless E3 ubiquitin protein ligase homolog (Drosophila) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most