-
Add to Cart The item has been addedHPA036363-100ULSigma-Aldrich
Anti-ECT2 antibody produced in rabbit (C15-1454-317)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to epithelial cell transforming 2 Sequence SLKEVMTHINEDKRKTEAQKQIFDVVYEVDGCPANLLSSHRSLVQRVETISLGEHPCDRGEQVTLFLFNDCLEIARKRHKVIGTFRSPH Application All Prestige Antibodies Powered by Atlas Antibodies are -
Add to Cart The item has been addedHPA053261-100ULSigma-Aldrich
Anti-ECT2 antibody produced in rabbit (C15-1461-282)
Price: $928.29List Price: $1,031.43Immunogen epithelial cell transforming 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA028459-100ULImmunogen endothelin 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedAV30074-100ULSigma-Aldrich
Anti-EEA1 antibody produced in rabbit (C15-1340-610)
Price: $898.29List Price: $998.10Early Endosome Antigen1 (EEA1) is a conserved protein that regulates vesicular transport of proteins in early endosomes. Rabbit Anti-EEA1 antibody recognizes mouse and human EEA1. -
Add to Cart The item has been addedHPA038158-100ULSigma-Aldrich
Anti-EEA1 antibody produced in rabbit (C15-1455-103)
Price: $928.29List Price: $1,031.43Immunogen early endosome antigen 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA038159-100ULSigma-Aldrich
Anti-EEA1 antibody produced in rabbit (C15-1455-104)
Price: $928.29List Price: $1,031.43Early endosome antigen 1 (EEA1) is a peripheral membrane protein, that has two zinc fingers, a C2H2-type at position 41–64 and a FYVE-type at position 1352–1410. It is located in the soma and in the postsynaptic nerve terminals. -
Add to Cart The item has been addedE7659-100ULMonoclonal Anti-EEA1 (mouse IgG2a isotype) is derived from the hybridoma EEA1-N19 produced by the fusion of mouse myeloma cells and splenocytes from BALB/c mice immunized with a synthetic peptide corresponding to a fragment of human EEA1. Early -
Add to Cart The item has been addedHPA051759-100ULSigma-Aldrich
Anti-EEF1A1 antibody produced in rabbit (C15-1460-776)
Price: $928.29List Price: $1,031.43Immunogen eukaryotic translation elongation factor 1 alpha 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA056990-100ULSigma-Aldrich
Anti-EEF1A1 antibody produced in rabbit (C15-1462-520)
Price: $928.29List Price: $1,031.43Immunogen eukaryotic translation elongation factor 1 alpha 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA053862-100ULImmunogen eukaryotic translation elongation factor 1 alpha 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA040417-100ULSigma-Aldrich
Anti-EEF1AKMT1 antibody produced in rabbit (C15-1456-194)
Price: $928.29List Price: $1,031.43Immunogen eukaryotic translation elongation factor 1 alpha lysine methyltransferase 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein -
Add to Cart The item has been addedHPA042543-100ULSigma-Aldrich
Anti-EEF1AKMT1 antibody produced in rabbit (C15-1457-256)
Price: $928.29List Price: $1,031.43Immunogen eukaryotic translation elongation factor 1 alpha lysine methyltransferase 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein
