-
HPA028487-100UL
Sigma-Aldrich
Anti-EIF4G1 antibody produced in rabbit (C15-1451-865)
Price: $879.43List Price: $977.14Immunogen eukaryotic translation initiation factor 4 gamma, 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and -
HPA043866-100UL
Sigma-Aldrich
Anti-EIF4G1 antibody produced in rabbit (C15-1457-913)
Price: $928.29List Price: $1,031.43Immunogen eukaryotic translation initiation factor 4 gamma, 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA006773-100UL
Sigma-Aldrich
Anti-EIF4G2 antibody produced in rabbit (C15-1446-726)
Price: $879.43List Price: $977.14EIF4G2 (Eukaryotic translation initiation factor 4, ─) is a 97kDa scaffold protein belonging to the eukaryotic translation initiation factor 4G family. It is primarily associated with the cap-independent translation of proteins. -
HPA016965-100UL
Sigma-Aldrich
Anti-EIF4G2 antibody produced in rabbit (C15-1448-645)
Price: $879.43List Price: $977.14EIF4G2 (Eukaryotic translation initiation factor 4, ─) is a 97kDa scaffold protein belonging to the eukaryotic translation initiation factor 4G family. It is primarily associated with the cap-independent translation of proteins. -
HPA040867-100UL
Sigma-Aldrich
Anti-ELAC1 antibody produced in rabbit (C15-1456-403)
Price: $928.29List Price: $1,031.43Immunogen elaC homolog 1 (E. coli) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA066483-100UL
Sigma-Aldrich
Anti-ELAC1 antibody produced in rabbit (C15-1465-090)
Price: $928.29List Price: $1,031.43Immunogen elaC ribonuclease Z 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA019535-100ULELAC2 (ElaC ribonuclease Z 2) is a cytosolic protein encoding a long form of RNase Z. It is expressed in the mitochondria and located at chromosome 17p11.
-
HPA046298-100ULImmunogen ELAV like RNA binding protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in
-
HPA063001-100ULImmunogen ELAV like neuron-specific RNA binding protein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
-
HPA043047-100ULImmunogen Recombinant protein corresponding to ELAV like RNA binding protein 4 Sequence VMIISTMEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein
-
HPA001600-100ULImmunogen ETS domain-containing protein Elk-3 recombinant protein epitope signature tag (PrEST) Application Anti-ELK3 antibody produced in rabbit is suitable for use to locate ELK3 DNA binding sites on a genome wide scale by a chromatin
-
HPA046076-100ULImmunogen elongation factor RNA polymerase II recombinant protein epitope signature tag (PrEST) Application Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.