-
Add to Cart The item has been addedHPA002822-100ULImmunogen EMILIN-1 precursor recombinant protein epitope signature tag (PrEST) Application Anti-EMILIN1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested -
Add to Cart The item has been addedHPA064576-100ULImmunogen Recombinant protein corresponding to elastin microfibril interfacer 2 Sequence RMLNGRLDNEFDRLIVPEPDVDFDAKWNELDARINVTEKNAEEHCFYIEETLRGAINGEVGDLKQLVDQKIQSLEDRLGSVLLQMTNNT Application All Prestige Antibodies Powered by Atlas Antibodies are -
Add to Cart The item has been addedHPA044034-100ULSigma-Aldrich
Anti-EMILIN3 antibody produced in rabbit (C15-1457-995)
Price: $928.29List Price: $1,031.43Immunogen elastin microfibril interfacer 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA059912-100ULSigma-Aldrich
Anti-EMILIN3 antibody produced in rabbit (C15-1463-406)
Price: $928.29List Price: $1,031.43Immunogen elastin microfibril interfacer 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA078559-100ULSigma-Aldrich
ANTI-EMILIN3 ANTIBODY PRODUCED IN RABBIT (C15-1467-172)
Price: $977.14List Price: $1,085.71Immunogen elastin microfibril interfacer 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA049105-100ULImmunogen echinoderm microtubule associated protein like 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA012757-100ULEchinoderm microtubule-associated protein-like 2 (EML2) is a 70kDa protein which contains a hydrophobic ELP (HELP) domain and a large tryptophan-aspartic acid (WD) repeat domain. The gene encoding it is present on chromosome 19. -
Add to Cart The item has been addedHPA054019-100ULSigma-Aldrich
Anti-EML5 antibody produced in rabbit (C15-1461-533)
Price: $928.29List Price: $1,031.43Immunogen echinoderm microtubule associated protein like 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as -
Add to Cart The item has been addedHPA055379-100ULSigma-Aldrich
Anti-EML5 antibody produced in rabbit (C15-1461-995)
Price: $928.29List Price: $1,031.43Immunogen echinoderm microtubule associated protein like 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as -
Add to Cart The item has been addedHPA062808-100ULSigma-Aldrich
Anti-EML6 antibody produced in rabbit (C15-1464-197)
Price: $928.29List Price: $1,031.43Immunogen echinoderm microtubule associated protein like 6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA068759-100ULSigma-Aldrich
Anti-EML6 antibody produced in rabbit (C15-1465-533)
Price: $928.29List Price: $1,031.43Immunogen echinoderm microtubule associated protein like 6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedAB5732Specificity Recognizes En1, (Engrailed family), a homeodomain transcription factor. Immunogen Synthetic peptide from human En1.
