Immunology

Immunogen ENTH domain-containing protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Ectonucleoside triphosphate diphosphohydrolase 1 recombinant protein epitope signature tag (PrEST) Application Anti-ENTPD1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA)

The gene ENY2 (enhancer of yellow 2 transcription factor homolog) is mapped to human chromosome 8q23-q24. It is part of the TFTC/STAGA (TBP-free TAF complex (TFTC) and SPT3/TAF9/GCN5 acetyltransferase (STAGA)) complex.

Specificity CBL419 is specific for eosinophil major basic protein irrespective of the stages of eosinophil activation and can be regarded as a pan-eosinophil" marker. This antibody will recognize the 23."

Immunogen EP400 N-terminal like Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Epithelial specific antigen, also known as epithelial cell adhesion molecule (Ep-CAM) and epithelial glycoprotein (EGP), may act as an interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the

Eps15, also known as Epidermal growth factor receptor substrate 15, Protein AF-1p, and encoded by the gene EPS15/AF1P, is an important protein involved in cell growth regulation, cell spreading, proliferation, invagination and budding. Epidermal

Epidermal growth factor receptor substrate 15 (EPS15) localizes to the clathrin-coated pits at the plasma membrane. It contains three N-terminal EPS15 homology (EH) domains, an intermediate coiled-coil domain and a binding domain at the C-terminal

Immunogen Recombinant protein corresponding to epidermal growth factor receptor pathway substrate 15 Sequence DPFKLNDPFQPFPGNDSPKEKDPEIFCDPFTSATTTTNKEADPSNFANFSAYPSEEDMIEWAKRESEREEEQRLARL Application All Prestige Antibodies Powered by Atlas

The gene EPS15L1 (epidermal growth factor receptor substrate 15-like 1) is mapped to human chromosome 19p13.11.

Immunogen epidermal growth factor receptor pathway substrate 15-like 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen EPS8-like 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most