-
Add to Cart The item has been addedHPA055751-100ULImmunogen family with sequence similarity 214, member B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA041021-100ULSigma-Aldrich
Anti-FAM217B antibody produced in rabbit (C15-1456-480)
Price: $928.29List Price: $1,031.43Immunogen chromosome 20 open reading frame 177 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedHPA056698-100ULSigma-Aldrich
Anti-FAM217B antibody produced in rabbit (C15-1462-425)
Price: $928.29List Price: $1,031.43Immunogen family with sequence similarity 217, member B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA040181-100ULSigma-Aldrich
Anti-FAM222A antibody produced in rabbit (C15-1456-095)
Price: $928.29List Price: $1,031.43Immunogen chromosome 12 open reading frame 34 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedHPA058774-100ULSigma-Aldrich
ANTI-FAM222A ANTIBODY PRODUCED IN RABBIT (C15-1463-049)
Price: $977.14List Price: $1,085.71Immunogen family with sequence similarity 222 member A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA071871-100ULImmunogen Recombinant protein corresponding to family with sequence similarity 234 member A Sequence REEVSGHLYSGSTGHQIGLRGSLGVDGESGFLLHVTRTGAHYILFPCASSLCGCSVKGLYEKVTGSGGPFKSDPHWESMLNATTRRM Application All Prestige Antibodies Powered by Atlas -
Add to Cart The item has been addedHPA010850-100ULImmunogen Recombinant protein corresponding to family with sequence similarity 234 member B Sequence DLSPLELADVNGDGLRDVLLSFVMSRNGSAVGVSRPAANLVCLSGMNGSTLWSSLLPEEARDITCLELMPGSLAETICLVTGTHKMLSAFNATSGKAIWTLNPNYLSNGTLAAPVVVLPDLDEDGVR Application All -
Add to Cart The item has been addedHPA073342-100ULImmunogen FAM240C Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human -
Add to Cart The item has been addedHPA051712-100ULImmunogen family with sequence similarity 32, member A recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA036582-100ULImmunogen family with sequence similarity 35, member A recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA060398-100ULImmunogen family with sequence similarity 49, member A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA009076-100ULFAM49B (family with sequence similarity 49 member B) is an inflammation-related protein. This gene is localized to human chromosome 8q24.
