Immunology

Monoclonal ANTI-FLAG M2 is a purified immunoglobulin, IgG1, monoclonal antibody, purified from culture supernatant of hybridoma cells, that binds to FLAG &#174 fusion proteins. Unlike ANTI-FLAG M1 antibody, the M2 antibody will recognize the FLAG

Monoclonal ANTI-FLAG M2 is a purified immunoglobulin, IgG1, monoclonal antibody, purified from culture supernatant of hybridoma cells, that binds to FLAG &#174 fusion proteins. Unlike ANTI-FLAG M1 antibody, the M2 antibody will recognize the FLAG

FLCN (folliculin) is located on human chromosome 17p11.2.

Filaggrin-2 (FLG2) is a 248 kDa S100 fused-type protein, that is insoluble in water. It is produced by granular keratinocytes and has 23 homologous repeats and a S100-homologous N-terminal domain.

Immunogen Fli-1 proto-oncogene, ETS transcription factor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Fli-1 proto-oncogene, ETS transcription factor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Mammalian homolog of drosophila flightless-1 is encoded by the FLII gene in human (also known as FLI, Fli1, or FLIL). The human flightless-1 homolog (Flii) contains sixteen 23-amino acid leucine-rich repeats (LRR) in its N-terminal half and a

In human Viral FLICE-inhibitory proteins (v-FLIPs) is identified as c-FLIP. It is composed of two death effector domains which have structural resemblance with the N-terminal half of caspase-8 and a caspase-like domain.

Immunogen Synthetic peptide directed towards the N terminal region of human FLJ14213 Sequence Synthetic peptide located within the following region: SAWNSVQTAVINVFKGGGLQSNELYALNENIRRLLKSELGSFITDYFQNQ Physical form Purified antibody supplied in 1x

FLJ37300 is a Kinesin-like protein also known as KIF19. It has a molecular weight of 111 kDa and is expressed with the cytoskeleton.

Flotillin-2 is a protein encoded by the FLOT2 gene in humans. Flotillin 2 is more widely distributed, but is absent in skeletal muscle.

FLT3 (Fms-like tyrosine kinase) is a member of the tyrosine kinase (RTK) family. It has an extracellular domain consisting of five immunoglobulin-like domains and an intracellular kinase domain interrupted by a kinase insert.