Immunology

Immunogen Recombinant protein corresponding to fms related tyrosine kinase 4 Sequence LEWAWPGAQEAPATGDKDSEDTGVVRDCEGTDARPYCKVLLLHEVHANDTGSYVCYYKYIKARIEGTTAASSYVFVRDFEQPFINKPDTLLVNRKDAMWVPCLVSIPGLNVTLRSQSSVLWPDGQEVVWDDRRGMLVSTPLLH Application All

Immunogen Recombinant protein corresponding to fms related tyrosine kinase 4 Sequence LQEEEEVCMAPRSSQSSEEGSFSQVSTMALHIAQADAEDSPPSLQRHSLAARYYNWVSFPGCLARGAETRGSSRMKTFEEFPMTPTTYK Application All Prestige Antibodies Powered by Atlas Antibodies are

Immunogen fms related tyrosine kinase 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Fluorescent Gold (hydroxystilbamidine), better known as Fluorogold, has been a very popular fluorescent marker used to retrogradely label projection neurons. AB153 also reacts with aminostilbamidine quite nicely in frozen, 4% PFA fixed tissues.

Immunogen feline leukemia virus subgroup C cellular receptor family, member 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas

Immunogen formation of mitochondrial complex V assembly factor 1 homolog recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen formation of mitochondrial complex V assembly factor 1 homolog recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen formin 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human

Formin-like 2 (FMNL2) belongs to the family of diaphanous-related formins (DRF), which are ubiquitously expressed and have highly conserved domains. FMNL2 is highly expressed in mammary and gastrointestinal epithelia, placenta, reproductive tract

FMNL (formin like) encodes a formin homology protein. It belongs to the formin family with three other members: FMNL1, FMNL2 and FMNL3.

FMNL3 (formin like 3) belongs to the FMNL family. The protein has a GTPase-binding domain, diaphanous inhibitory domain, dimerization domain, formin homology 1 domain, formin homology 2 domain, WH2-like domain and diaphanous autoregulatory domain.

Dimethylaniline monooxygenase [N-oxide-forming] 2 (EC 1.14.