Immunology

Formyl peptide receptors (FPRs) are G protein coupled receptors critical for our immune response and the cellular activation and or suppression of immune cell activities. N-formyl peptides are produced by the degradation of either bacteria or host

Immunogen formyl peptide receptor 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

FREQ (NCS1) is a neuronal calcium sensor that modulates G protein-coupled receptor (GPCR) phosphorylation and synaptic functions. Interaction between variation in the DRD2 and FREQ genes can be used to predict the efficacy of nicotine replacement

Immunogen Recombinant protein corresponding to fyn related Src family tyrosine kinase Sequence RIKRLDEGGFFLTRRRIFSTLNEFVSHYTKTSDGLCVKLGKPCLKIQVPAPFDLSYKTVDQ Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated

Immunogen fyn related Src family tyrosine kinase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen FERM domain containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen FERM domain containing 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

FERM domain containing 4A (FRMD4A) is a member of the four-point-one, ezrin, radixin, moesin (FERM) superfamily of proteins. As the name suggests, the protein contains FERM domain, which is implicated in linking transmembrane proteins to the

FRMD4B (FERM domain containing 4B) is a highly polymorphic gene localized to human chromosome 3p14.1 and is composed of 24 exons.

Immunogen FERM domain-containing protein 8 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen FERM domain containing 8 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Ferric-chelate reductase 1 (FRRS1) is expressed in the brain. Immunogen Ferric-chelate reductase 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the