Immunology

Immunogen ARF GTPase-activating protein GIT1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

GIT1 (G protein-coupled receptor kinase interactor 1) is an adaptor protein involved in the GTPase-activating protein activity for the ADP-ribosylating factor. It is also named as Cat-1, p95-APP1 and p95PKL.

Immunogen gap junction protein, alpha 1, 43kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Recombinant protein corresponding to gap junction protein alpha 1 Sequence GKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQAS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by

Immunogen gap junction protein, alpha 3, 46kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen gap junction protein, alpha 4, 37kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen gap junction protein alpha 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Recombinant protein corresponding to gap junction protein alpha 8 Sequence SLHSIAVSSIQKAKGYQLLEEEKIVSHYFPLTEVGMVETSPLPAKPFNQFEEKISTGPLGDLSRGYQETLPSYAQVGAQEVEGEGPPAEEGAEPEVGEKKEEAERLTTEEQEKVAVPEGEKVETPGVDKEGEKEEPQSEKVSKQGLP Application All

Immunogen Recombinant protein corresponding to gap junction protein alpha 8 Sequence VHYVRMEEKRKSREAEELGQQAGTNGGPDQGSVKKSSGSKGTKKFRLEGTLL Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human

Immunogen gap junction protein, alpha 9, 59kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Synthetic peptide directed towards the N terminal region of human GJB2 Biochem/physiol Actions GJB2 also known as connexin 26 is a gap junction protein that belongs to the connexin family. It is a component of the gap junctions between

Immunogen gap junction protein, beta 3, 31kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization