-
Add to Cart The item has been addedHPA075056-100ULSigma-Aldrich
ANTI-GUCA1A ANTIBODY PRODUCED IN RABBIT (C15-1466-667)
Price: $977.14List Price: $1,085.71Immunogen guanylate cyclase activator 1A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA055479-100ULImmunogen Recombinant protein corresponding to guanylate cyclase activator 1B Sequence GQEFSWEEAEAAGEIDVAELQEWYKKFVMECPSGTLFMHEFKRFFKVTDDEEASQYVEGMFRAFDKNG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated -
Add to Cart The item has been addedHPA041597-100ULGuanylate cyclase activator 1C (GUCA1C), also known as guanylate cyclase activating protein 3 (GCAP3), is encoded by the gene mapped to human chromosome 3q13.1. -
Add to Cart The item has been addedHPA018215-100ULThe gene guanylate cyclase activator 2A (GUCA2A) is mapped to human chromosome 1p35-p34. GUCA2A mRNA is mainly detected in the gastrointestinal tract and kidney. -
Add to Cart The item has been addedG5922-200ULGW182 is a phosphorylated cytoplasmic autoantigen. It contains multiple glycine-tryptophan (GW) repeats along with a single RNA recognition motif. -
Add to Cart The item has been addedHPA041598-100ULImmunogen glycogen synthase 1 (muscle) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA039482-100ULImmunogen glycogen synthase 2 (liver) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA054134-100ULSigma-Aldrich
Anti-GZMA antibody produced in rabbit (C15-1461-584)
Price: $928.29List Price: $1,031.43Immunogen granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA076751-100ULSigma-Aldrich
ANTI-GZMA ANTIBODY PRODUCED IN RABBIT (C15-1466-940)
Price: $977.14List Price: $1,085.71Immunogen granzyme A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
Add to Cart The item has been addedHPA029200-100ULImmunogen granzyme H (cathepsin G-like 2, protein h-CCPX) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as -
Add to Cart The item has been addedHPA063181-100ULSigma-Aldrich
Anti-GZMK antibody produced in rabbit (C15-1464-295)
Price: $928.29List Price: $1,031.43Immunogen granzyme K (granzyme 3 tryptase II) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA065895-100ULSigma-Aldrich
ANTI-GZMK ANTIBODY PRODUCED IN RABBIT (C15-1464-982)
Price: $977.14List Price: $1,085.71Immunogen granzyme K Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The
