Immunology

Immunogen HRAS-like suppressor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

HRAS-like suppressor 2 (HRASLS2) belongs to type II tumor suppressor HREV107 family and is expressed predominantly in trachea, intestine and kidney. It has N-terminal proline-rich region, a lecithin:retinol acyltransferase homology domain (LRAT)

Synoviolin (SYVN1) is an endoplasmic reticulum (ER)-membrane resident E3 ubiquitin ligase. The SYVN1 gene is mapped to human chromosome 11q13.

Heparan sulfate (glucosamine) 3-O-sulfotransferase 5 (HS3ST5) is a 3-OST homologous, type II membrane-bound protein consisting of a transmembrane domain and a functional sulfotransferase domain. It is highly expressed in fetal brain, followed by

Immunogen heparan sulfate (glucosamine) 3-O-sulfotransferase 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen heparan sulfate 6-O-sulfotransferase 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Recombinant protein corresponding to heparan sulfate 6-O-sulfotransferase 3 Sequence QQRYHHTKQLEHQRDRQKRREERRLQREHRDHQWPKEDGAAEGTVTEDYNSQVVRW Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by

The gene HSD17B14 (17-&#946-hydroxysteroid dehydrogenase 14) is mapped to human chromosome 19q13.33.

Immunogen hydroxysteroid (17-beta) dehydrogenase 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Estradiol 17-beta-dehydrogenase 12 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

17-&#946 hydroxysteroid dehydrogenase 13 (HSD17B13) belonging to a 15-member family is expressed specifically in hepatocytes in the liver. It is also expressed in the kidney.

Immunogen hydroxysteroid (17-beta) dehydrogenase 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive