Immunology

Interleukin 22 (IL-22) belongs to the IL10 family of T-cell associated cytokines, highly expressed in &#945&#946 and &#947&#948 T cells, as well as in innate lymphoid cells. Inflammatory cells associated with the thymus, pancreas, synovium,

Immunogen interleukin 22 receptor, alpha 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

IL27RA (also known as Interleukin-27 receptor subunit alpha, Cytokine receptor WSX-1, Cytokine receptor-like 1, Type I T-cell cytokine receptor, TCCR and ZcytoR1) is a receptor for IL27 and requires IL6ST/gp130 to mediate signal transduction in

Immunogen interleukin 27 receptor subunit alpha Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Synthetic peptide directed towards the N terminal region of human IL28RA Biochem/physiol Actions IL28RA belongs to the class II cytokine receptor family. This protein forms a receptor complex with interleukine 10 receptor, beta (IL10RB).

Immunogen interleukin 2 receptor, alpha Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen interleukin 2 receptor, beta Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Recombinant protein corresponding to interleukin 31 receptor A Sequence ILKPCSTPSDKLVIDKLVVNFGNVLQEIFTDEARTGQENNLGGEKNGYVTCPFRPDCPLGKSFEELPVSPEIPPRKSQYLR Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

IL32 (interleukin-32) is a proinflammatory cytokine. It is expressed in 9 unique isoforms - IL-32&#945, &#946, &#947, &#948, &#949, &#950, &#951, &#963 and &#952.

Immunogen interleukin 33 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen Interleukin-33 Precursor recombinant protein epitope signature tag (PrEST) Application Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below. Immunohistochemistry (1

Immunogen interleukin 1 family, member 8 (eta) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,