-
Add to Cart The item has been addedHPA013335-100ULSigma-Aldrich
Anti-INTS6L antibody produced in rabbit (C15-1447-953)
Price: $879.43List Price: $977.14DDX26B (DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 26B) gene encodes a human DEAD-box RNA helicase that is ATP-dependent. The DDX26 gene consists of 14 exons spanning a length of 8,123bp of genomic sequence. -
Add to Cart The item has been addedHPA030747-100ULSigma-Aldrich
Anti-INTS6L antibody produced in rabbit (C15-1452-816)
Price: $879.43List Price: $977.14Immunogen integrator complex subunit 6 like recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA072611-100ULImmunogen Recombinant protein corresponding to integrator complex subunit 7 Sequence GDGMLGDLMELYKVIGRSATDKQQELLVSLATVIFVASQKALSVESKAVIKQQLESVSNGWTVYRIARQASRMGNHDMAKELYQSLLTQVA Application All Prestige Antibodies Powered by Atlas Antibodies are -
Add to Cart The item has been addedAB9074Specificity IP3 Receptor 2. Immunogen Synthetic peptide from the C terminus of human IP3 Receptor 2. -
Add to Cart The item has been addedHPA040825-100ULInositol hexakisphosphate kinase (IP6K1) is encoded by the gene mapped to human chromosome 3p21.31. -
Add to Cart The item has been addedHPA053644-100ULSigma-Aldrich
Anti-IP6K3 antibody produced in rabbit (C15-1461-403)
Price: $928.29List Price: $1,031.43Immunogen inositol hexakisphosphate kinase 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA062531-100ULSigma-Aldrich
ANTI-IP6K3 ANTIBODY PRODUCED IN RABBIT (C15-1464-112)
Price: $977.14List Price: $1,085.71Immunogen inositol hexakisphosphate kinase 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA037837-100ULSigma-Aldrich
Anti-IPMK antibody produced in rabbit (C15-1454-935)
Price: $928.29List Price: $1,031.43The gene encoding inositol polyphosphate multikinase (IPMK) enzyme is located on human chromosome 10q21.1. -
Add to Cart The item has been addedHPA057542-100ULSigma-Aldrich
Anti-IPMK antibody produced in rabbit (C15-1462-685)
Price: $928.29List Price: $1,031.43Immunogen inositol polyphosphate multikinase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA075545-100ULImmunogen intracisternal A particle-promoted polypeptide Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA020603-100ULInositol-pentakisphosphate 2-kinase (IPPK) mRNA has been shown to be expressed in the heart, brain, testis and placenta. The gene encoding it is localized on human chromosome 9. -
Add to Cart The item has been addedHPA042028-100ULImmunogen IQ motif containing B1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported
