Immunology

Immunogen Interferon regulatory factor 8 recombinant protein epitope signature tag (PrEST) Sequence PDFEEVTDRSQLDISEPYKVYRIVPEEEQKCKLGVATAGCVNEVTEMECGRSEIDELIKEPSVDDYMGMIKRSPSPPEACRSQLLPDWWAQQPSTGVPLVTGYTTYDAHHSAFSQMVISFYY Application All Prestige

Specificity Note: The Ensemble Gene ID has changed from ENSG00000092098 in the 46:36 release of the database to ENSG00000213928 in the 48:36 release of the database. Immunogen Interferon regulatory factor 9 recombinant protein epitope signature tag

Immunogen immunity-related GTPase family, cinema recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen immunity-related GTPase family, cinema Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunity-related GTPase family M protein (IRGM), also known as Interferon-inducible protein 1 (IFI1) and LPS-stimulated RAW 264.7 macrophage protein 47 homolog (LRG-47), is a member of the interferon-inducible GTPase family.

Immunogen immunity-related GTPase family, Q recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen immunity-related GTPase family, Q Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Iron regulatory proteins (IRP-1 and IRP-2) are cytoplasmic mRNA-binding proteins that control intracellular iron levels by regulating the translation of ferritin, Tfrs, and other proteins congaing iron-responsive element (IRE) located at the

Immunogen iroquois homeobox 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen iroquois homeobox 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen iroquois homeobox 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen iroquois homeobox 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the