Immunology

Immunogen Janus kinase 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen janus kinase and microtubule interacting protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and

Immunogen janus kinase and microtubule interacting protein 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and

Immunogen janus kinase and microtubule interacting protein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Janus kinase and microtubule-interacting protein 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and

Immunogen Recombinant protein corresponding to junctional adhesion molecule 2 Sequence GVCYAQRKGYFSKETSFQKSNSSSKATTMS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen Recombinant protein corresponding to junctional adhesion molecule 2 Sequence SCEARNSVGYRRCPGKRMQVDDLNI Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

The gene Junctional adhesion molecule 3 (JAM3 JAM-C) is mapped to human chromosme 11q25. JAM3 is a type I transmembrane glycoprotein and contains Ig-like domains.

Junctional adhesion molecule 3 (JAM3) is a protein encoded by the JAM3 gene in humans. It is a member of the immunoglobulin superfamily.

Immunogen junctional adhesion molecule 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

JARID1C, also known as Jumonji/ARID domain-containing protein 1C, Protein SmcX, or Protein Xe169, and encoded by the gene KDM5C/DXS1272E/JARID1/SMCX/XE169, a histone demethylase that specifically demethylates &#8242Lys-4&#8242 of histone H3,

Also known as Lysine-specific demethylase 5D, this histone demethylase is specific for &#8242Lys-4&#8242 of histone H3 and is known to play a central role in histone function and spermatogenesis. It demethylates trimethylated and dimethylated,