Immunology

Immunogen Kruppel-like factor 3 (basic) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Kruppel-like factor 3 (basic) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Specificity Recognizes KLF4. The calculated molecular weight is ~50.

Immunogen Krueppel-like factor 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Kelch domain-containing protein 10 (KLHDC10) possesses kelch motifs. Immunogen Kelch domain-containing protein 10 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

The gene KLHDC2 is localized to chromosome 14q21.3 along with KLHDC1 and is predominantly found in the nucleus.

Immunogen Kelch domain-containing protein 8B recombinant protein epitope signature tag (PrEST) Sequence GTVAHQDGHLLVLGGCGRAGLPLDTAETLDMASHTWLALAPLPTARAGAAAVVLGKQVLVVGGVDEVQSPVAAVEAFLMDEGRWERRATLPQAAMGVATVERDGMVYALG Application All Prestige

The gene KLHDC8B (kelch domain containing 8B) encodes a protein containing seven kelch repeat domains that is expressed during mitosis. The gene is mapped to human chromosome 3p21.

KLHL11 (kelch like family member 11) is a BTB (Bric-a-brac, Tramtrack, and Broad complex)-Kelch protein. It associates with Cullin-3.

Immunogen kelch like family member 11 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen kelch-like family member 11 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen kelch-like family member 12 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the