Immunology

Immunogen kynurenine aminotransferase 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen kynurenine aminotransferase 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Synthetic peptide directed towards the N terminal region of human KYNU Application Anti-KYNU (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 5&#956g/ml. Biochem/physiol Actions KYNU gene encodes a

Families of adhesion molecules which share common carbohydrate domains do exist, despite the structural and functional diversity of these glycoproteins. These include the Ca2+-independent neural adhesion molecules (N-CAM), myelin associated

The gene L1CAM (L1 cell adhesion molecule) encodes a member of the immunoglobulin supergene family. The encoded protein contains a cytoplasmic intracellular domain, one single-pass transmembrane region and an extracellular domain containing six

Immunogen Recombinant protein corresponding to l(3)mbt-like 1 (Drosophila) Sequence STVAKWTIDEVFGFVQTLTGCEDQARLFKDEARIVRVTHVSGKTLVWTVAQLGDLVCSDHLQEGKGILETGVHSLLCSLPTHLL Application All Prestige Antibodies Powered by Atlas Antibodies are developed

Immunogen l(3)mbt-like 3 (Drosophila) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen l(3)mbt-like 3 (Drosophila) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen l(3)mbt-like 4 (Drosophila) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen l(3)mbt-like 4 (Drosophila) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Laccase domain containing 1 (LACC1) gene codes for fatty acid metabolism-immune nexus (FAMIN). LACC1 protein belongs to the blue multicopper oxidases family.

Immunogen lactamase beta like 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the