Immunology

Immunogen lysosomal protein transmembrane 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen LARGE xylosyl- and glucuronyltransferase 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen La ribonucleoprotein domain family, member 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen La ribonucleoprotein domain family, member 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen La ribonucleoprotein domain family, member 1B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen La ribonucleoprotein domain family, member 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen La ribonucleoprotein domain family, member 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

La ribonucleoprotein domain family member 4B (LARP4B) is encoded by the gene mapped to human chromosome 10p15.3.

Immunogen La ribonucleoprotein domain family, member 4B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Synthetic peptide directed towards the C terminal region of human LARP7 Sequence Synthetic peptide located within the following region: HCWKLEILSGDHEQRYWQKILVDRQAKLNQPREKKRGTEKLITKAEKIRL Physical form Purified antibody supplied in 1x PBS

La ribonucleoprotein domain family member 7 (LARP7), also known as HDCMA18P or PIP7S, is the member of LARP RNA-binding protein family. The gene coding for this oligopyrimidine-binding protein is mapped near human chromosome 4q25.

Immunogen La ribonucleoprotein domain family, member 7 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a