-
HPA004106-100ULImmunogen Junctophilin-4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the
-
HPA054999-100ULImmunogen adaptor-related protein complex 1, mu 2 subunit Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
-
HPA049894-100ULImmunogen adaptor-related protein complex 1, sigma 2 subunit recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and
-
AV53577-100ULImmunogen Synthetic peptide directed towards the C terminal region of human AP2B1 Biochem/physiol Actions AP2B1 is one of two large chain components of the assembly protein complex 2, which serves to link clathrin to receptors in coated vesicles.
-
HPA056733-100UL
Sigma-Aldrich
Anti-AP2B1 antibody produced in rabbit (C15-1462-433)
Price: $928.29List Price: $1,031.43Immunogen adaptor-related protein complex 2, beta 1 subunit Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA067983-100UL
Sigma-Aldrich
Anti-AP2B1 antibody produced in rabbit (C15-1465-416)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to adaptor related protein complex 2 beta 1 subunit Sequence PPNAFVEGSHGIHRKHLPIHHGSTDAGDSPVGTTTATNLEQPQVIPSQGDLL Application All Prestige Antibodies Powered by Atlas Antibodies are developed and -
HPA036849-100UL
Sigma-Aldrich
Anti-AP2M1 antibody produced in rabbit (C15-1454-583)
Price: $928.29List Price: $1,031.43The gene AP2M1 (adaptor related protein complex 2 μ 1 subunit) is mapped to human chromosome 3q27.1. -
HPA069870-100UL
Sigma-Aldrich
Anti-AP2M1 antibody produced in rabbit (C15-1465-774)
Price: $928.29List Price: $1,031.43Immunogen adaptor-related protein complex 2, mu 1 subunit Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA038737-100UL
Sigma-Aldrich
Anti-AP3B1 antibody produced in rabbit (C15-1455-422)
Price: $928.29List Price: $1,031.43Immunogen adaptor-related protein complex 3, beta 1 subunit recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and -
HPA045458-100UL
Sigma-Aldrich
Anti-AP3B1 antibody produced in rabbit (C15-1458-525)
Price: $928.29List Price: $1,031.43Immunogen adaptor-related protein complex 3, beta 1 subunit Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA039467-100UL
Sigma-Aldrich
Anti-AP3B2 antibody produced in rabbit (C15-1455-750)
Price: $928.29List Price: $1,031.43Immunogen adaptor-related protein complex 3, beta 2 subunit recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and -
HPA039818-100UL
Sigma-Aldrich
Anti-AP3B2 antibody produced in rabbit (C15-1455-917)
Price: $928.29List Price: $1,031.43Immunogen adaptor-related protein complex 3, beta 2 subunit recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and