-
Add to Cart The item has been addedHPA020017-100ULSigma-Aldrich
Anti-LUC7L3 antibody produced in rabbit (C15-1449-493)
Price: $879.43List Price: $977.14LUC7L3 (LUC7-like 3 pre-mRNA splicing factor) is a novel nuclear protein localized in the nucleus, with speckled distribution. It is mapped to human chromosome 17q21. -
Add to Cart The item has been addedHPA030060-100ULSigma-Aldrich
Anti-LURAP1 antibody produced in rabbit (C15-1452-510)
Price: $879.43List Price: $977.14Immunogen Uncharacterized protein C1orf190 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA030061-100ULSigma-Aldrich
Anti-LURAP1 antibody produced in rabbit (C15-1452-511)
Price: $879.43List Price: $977.14Immunogen Uncharacterized protein C1orf190 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA024407-100ULImmunogen Uncharacterized protein C9orf150 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA046436-100ULSigma-Aldrich
Anti-LUZP4 antibody produced in rabbit (C15-1458-853)
Price: $928.29List Price: $1,031.43Immunogen leucine zipper protein 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA051999-100ULSigma-Aldrich
Anti-LUZP4 antibody produced in rabbit (C15-1460-870)
Price: $928.29List Price: $1,031.43Immunogen leucine zipper protein 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA024755-100ULSigma-Aldrich
Anti-LY6D antibody produced in rabbit (C15-1450-878)
Price: $977.14List Price: $1,085.71The gene LY6D (lymphocyte antigen 6 complex, locus D) is mapped to human chromosome 8q24.3. -
Add to Cart The item has been addedHPA064317-100ULSigma-Aldrich
Anti-LY6D antibody produced in rabbit (C15-1464-608)
Price: $928.29List Price: $1,031.43Immunogen lymphocyte antigen 6 complex, locus D Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA048307-100ULImmunogen lymphocyte antigen 6 complex, locus G5B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA038690-100ULImmunogen Lymphocyte antigen 6 complex locus protein G5c Precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedHPA056234-100ULImmunogen Recombinant protein corresponding to lymphocyte antigen 6 family member G6E Sequence VPTECRDDEACGISIGTSGRTLVQWPFSRRLPTSIHPAFPVAPASACLFHPTDQSEITE Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated -
Add to Cart The item has been addedHPA077218-100ULImmunogen lymphocyte antigen 6 family member H Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
