-
HPA003635-100ULImmunogen Mitotic spindle assembly checkpoint protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a
-
HPA003348-100ULImmunogen MAD2 mitotic arrest deficient-like 1 (yeast) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a
-
HPA028729-100ULImmunogen MAD2L1 binding protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
-
HPA024176-100UL
Sigma-Aldrich
Anti-MAD2L2 antibody produced in rabbit (C15-1450-659)
Price: $879.43List Price: $977.14Immunogen MAD2 mitotic arrest deficient-like 2 (yeast) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA024612-100UL
Sigma-Aldrich
ANTI-MAD2L2 ANTIBODY PRODUCED IN RABBIT (C15-1450-818)
Price: $977.14List Price: $1,085.71Immunogen mitotic arrest deficient 2 like 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA077998-100ULImmunogen mucosal vascular addressin cell adhesion molecule 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
-
HPA078602-100ULImmunogen Recombinant protein corresponding to maelstrom spermatogenic transposon silencer Sequence PVFTPLRRPGMLVPKQNVSPPDMSALSLKGDQALLGGIFYFLNIFSHGELPPHCEQRFLPCEIGCVKYSLQEGIMADFH Application All Prestige Antibodies Powered by Atlas Antibodies are
-
ABE1928Transcription factor MafK (UniProt Q61827 also known as Erythroid transcription factor NF-E2 p18 subunit, Nuclear factor erythroid derived 2 ubiquitous, p18 NF-E2) is encoded by the Mafk (also known as Nfe2u, AW061068) gene (Gene ID 17135) in
-
HPA003333-100UL
Sigma-Aldrich
Anti-MAGEA10 antibody produced in rabbit (C15-1445-898)
Price: $879.43List Price: $977.14Immunogen melanoma antigen family A, 10 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA070780-100UL
Sigma-Aldrich
Anti-MAGEA10 antibody produced in rabbit (C15-1465-907)
Price: $928.29List Price: $1,031.43Immunogen melanoma antigen family A10 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA052687-100ULImmunogen melanoma antigen family A11 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
-
HPA000611-100ULImmunogen Melanoma-associated antigen B10 recombinant protein epitope signature tag (PrEST) Application Anti-MAGEB10 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each