-
HPA041594-100UL
Sigma-Aldrich
Anti-MDM1 antibody produced in rabbit (C15-1456-782)
Price: $928.29List Price: $1,031.43Immunogen Mdm1 nuclear protein homolog (mouse) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA029666-100ULImmunogen MDN1, midasin homolog (yeast) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
-
HPA003064-100UL
Sigma-Aldrich
Anti-MDP1 antibody produced in rabbit (C15-1445-771)
Price: $879.43List Price: $977.14Immunogen magnesium-dependent phosphatase 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA070338-100UL
Sigma-Aldrich
Anti-MDP1 antibody produced in rabbit (C15-1465-828)
Price: $928.29List Price: $1,031.43Immunogen magnesium-dependent phosphatase 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA052999-100ULImmunogen myelodysplastic syndrome 2 translocation associated recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and
-
HPA006493-100ULME1 (malic enzyme 1) exists as a homotetaramer, where its two dimers are linked to each other. It is one of the three isoforms of ME enzyme, which are classified according to their sub-cellular localization and cofactor specificity.
-
HPA008247-100UL
Sigma-Aldrich
Anti-ME2 antibody produced in rabbit (C15-1447-094)
Price: $879.43List Price: $977.14Immunogen NAD-dependent malic enzyme, mitochondrial precursor recombinant protein epitope signature tag (PrEST) Sequence DGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWPESASSPPV -
HPA008880-100UL
Sigma-Aldrich
Anti-ME2 antibody produced in rabbit (C15-1447-248)
Price: $879.43List Price: $977.14Immunogen NAD-dependent malic enzyme, mitochondrial precursor recombinant protein epitope signature tag (PrEST) Sequence -
AV48511-100UL
Sigma-Aldrich
Anti-ME3 antibody produced in rabbit (C15-1341-700)
Price: $898.29List Price: $998.10Immunogen Synthetic peptide directed towards the N terminal region of human ME3 Application Rabbit Anti-ME3 antibody is suitable for western blot applications at a concentration of 1μg/ml. Biochem/physiol Actions Malic enzyme catalyzes the -
HPA038473-100UL
Sigma-Aldrich
Anti-ME3 antibody produced in rabbit (C15-1455-270)
Price: $928.29List Price: $1,031.43Malic enzyme 3 (ME3) is a NADP(+)-dependent mitochondrial protein, encoded by the gene mapped to human chromosome 11q14.2. -
HPA073087-100ULImmunogen male-enhanced antigen 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
-
HPA046537-100ULImmunogen MDS1 and EVI1 complex locus recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are