-
Add to Cart The item has been addedHPA063788-100ULSigma-Aldrich
ANTI-MEOX1 ANTIBODY PRODUCED IN RABBIT (C15-1464-485)
Price: $977.14List Price: $1,085.71Immunogen mesenchyme homeobox 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA053793-100ULImmunogen mesenchyme homeobox 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
Add to Cart The item has been addedHPA029416-100ULImmunogen meprin A, alpha (PABA peptide hydrolase) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA029119-100ULImmunogen meprin A, beta Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
Add to Cart The item has been addedHPA038003-100ULSigma-Aldrich
Anti-MEPE antibody produced in rabbit (C15-1455-018)
Price: $928.29List Price: $1,031.43Immunogen matrix extracellular phosphoglycoprotein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA038004-100ULSigma-Aldrich
Anti-MEPE antibody produced in rabbit (C15-1455-019)
Price: $928.29List Price: $1,031.43Immunogen matrix extracellular phosphoglycoprotein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA075622-100ULImmunogen MER proto-oncogene, tyrosine kinase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA071716-100ULImmunogen Recombinant protein corresponding to mesoderm development candidate 1 Sequence LLTQCLRDLAQHPDGGAKMSDHRERLRNSACAVSEGCTLLSQALRERSSPRTLPPVNSNSVN Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by -
Add to Cart The item has been addedHPA039414-100ULImmunogen mesoderm development candidate 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA069981-100ULImmunogen mesoderm posterior bHLH transcription factor 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA005623-100ULMesoderm-specific transcript homolog protein (MEST) is a protein product of an imprinted MEST/PEG1 gene located on the chromosome that is expressed from the parental allele in majority of cell lines and foetal tissues. The gene is transcribed from -
Add to Cart The item has been addedHPA019095-100ULThe gene METAP2 (methionine aminopeptidase 2) is mapped to human chromosome 12q22. The protein localizes in the cytoplasm.
