Immunology

MKLN1 (Muskelin 1, intracellular mediator containing kelch motifs) is a primarily cytoplasmic protein consisting of mainly two domains, N- and C-terminal domains. Specifically, it is composed of a discoidin-like domain and a LiSH/CTLH domain.

Immunogen muskelin 1, intracellular mediator containing kelch motifs Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen MAP kinase interacting serine/threonine kinase 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

MKNK2 (MAP kinase interacting serine/threonine kinase 2) is a serine threonine kinase belonging to the human MAP kinase-interacting kinases group. It consists of a zinc-binding domain and an atypical open conformation region.

Immunogen Recombinant protein corresponding to MAP kinase interacting serine/threonine kinase 2 Sequence AIAMNRQLAQHDEDLAEEEAAGQGQPVLVRATSRCLQLSPPSQSKLAQ Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by

Makorin-2 (MKRN2) is a novel ubiquitin E3 ligase that is also known as HSPC070. It is a member of the MKRN gene family.

Makorin ring finger protein 2 (MKRN2) belongs to makorin RING (Really Interesting New Gene) zinc-finger family and is a 42 kDa ribonucleoprotein. It has zinc finger motifs in N and C-terminus.

Immunogen MKRN2 opposite strand Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen MKRN2 opposite strand Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

MKRN3 (makorin ring finger protein 3) is located on human chromosome 15q11. It is an intronless gene.

The gene MKS1 (meckel syndrome type 1) is mapped to human chromosome 17q23. The protein localizes to centrosomes.

MKS1 (Meckel syndrome, type 1) is a novel evolutionarily conserved cytosolic protein localized in basal bodies. Its expression has been found in the brain, liver, kidney and the cartilage tissue of the developing upper limbs.