Immunology

MKX (Mohawk homeobox) is a novel atypical homeodomain-containing protein belonging to the Iroquois-related homeobox (IRX) gene family. It is localized in the nucleus of the bone marrow, brain, heart, kidney, liver, lung, pancreas, prostate,

Immunogen Membrane protein MLC1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen megalencephalic leukoencephalopathy with subcortical cysts 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen myeloid leukemia factor 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Synthetic peptide directed towards the C terminal region of human MLF2 Application Anti-MLF2 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 0.25&#956g/ml.

MLF2 (myeloid leukemia factor 2) is a 248 amino acid protein, which shares high similarity with MLF1 protein. This gene is localized to human chromosome 12p13, and has an open reading frame of 744bp.

MLF2 (myeloid leukemia factor 2) is a 248 amino acid protein, which shares high similarity with MLF1 protein. This gene is localized to human chromosome 12p13, and has an open reading frame of 744bp.

Immunogen mutL homolog 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen mutL homolog 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen mutL homolog 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen Recombinant protein corresponding to muscular LMNA interacting protein Sequence SKDNTLEPPVETPTTLPRAAGRETKYANLSSPTSTVSESQLTKPGVIRPVPVKSRI Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the

MLK1 (MAP3K9) is a serine&#8211threonine kinase of the Mixed-Lineage Kinase (MLK) family capable of activating the c-Jun N-terminal Kinase (JNK)/Mitogen-Activated Protein Kinase (MAPK) pathway and regulating the other two prinicpal MAPK cascades,