Immunology

Immunogen Synthetic peptide directed towards the N terminal region of human MLX Biochem/physiol Actions MLX belongs to the family of basic helix-loop-helix leucine zipper (bHLH-Zip) transcription factors. These factors form heterodimers with Mad

Immunogen MLX, MAX dimerization protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen MLX, MAX dimerization protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

MLXIP (MLX interacting protein) belongs to the basic helix-loop-helix leucine zipper (bHLHZip) family of transcription factors. The gene is mapped to human chromosome 12q24.

Immunogen MLX interacting protein-like Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen malonyl-CoA decarboxylase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Membrane metalloendopeptidase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen Membrane metallo-endopeptidase-like 1 recombinant protein epitope signature tag (PrEST) Sequence

Immunogen Membrane metallo-endopeptidase-like 1 recombinant protein epitope signature tag (PrEST) Sequence SVIEKRGSQPLLDILEVVGGWPVAMDRWNETVGLEWELERQLALMNSQFNRRVLIDLFIWNDDQNSSRHIIYIDQPTLGMPSREYYFNGGSNRKVREAYLQFMVSVATLLREDANLPRDSCLVQEDMVQVLEL

Immunogen membrane magnesium transporter 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

All cells within tissues are surrounded by an extracellular matrix (ECM) giving the tissues shape and structure. The ECM is constantly being remodeled and constant communication is maintained between cells through this matrix.

Matrix metallopeptidase 12 (MMP-12) is able to degrade elastin, entactin, laminin-1, fibronectin, type IV collagen as well as insulin B-chain and casein. MMP-12 is structurally similar to the classical MMPs (MMP-1, MMP-3) it contains a propeptide