-
HPA076790-100UL
Sigma-Aldrich
Anti-MRPL14 antibody produced in rabbit (C15-1466-946)
Price: $928.29List Price: $1,031.43Immunogen mitochondrial ribosomal protein L14 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA044425-100ULImmunogen mitochondrial ribosomal protein L15 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,
-
HPA054133-100ULImmunogen mitochondrial ribosomal protein L16 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,
-
HPA007455-100UL
Sigma-Aldrich
Anti-MRPL2 antibody produced in rabbit (C15-1446-896)
Price: $879.43List Price: $977.14Immunogen 39S ribosomal protein L2, mitochondrial precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and -
HPA064814-100UL
Sigma-Aldrich
Anti-MRPL2 antibody produced in rabbit (C15-1464-739)
Price: $928.29List Price: $1,031.43Immunogen mitochondrial ribosomal protein L2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA030295-100UL
Sigma-Aldrich
Anti-MRPL24 antibody produced in rabbit (C15-1452-640)
Price: $879.43List Price: $977.14Immunogen mitochondrial ribosomal protein L24 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA054323-100UL
Sigma-Aldrich
Anti-MRPL24 antibody produced in rabbit (C15-1461-642)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to mitochondrial ribosomal protein L24 Sequence ERVRVSTRSGRIIPKPEFPRADGIVPETWIDGPKDTSVEDALERTYVPCLKTLQEEVMEAMGIKETRKYKKVYW Application All Prestige Antibodies Powered by Atlas Antibodies are developed and -
HPA021416-100ULThe gene MRPL27 (39S ribosomal protein L27, mitochondrial) is mapped to human chromosome 17q21.3-q22.
-
HPA030594-100UL
Sigma-Aldrich
Anti-MRPL28 antibody produced in rabbit (C15-1452-765)
Price: $879.43List Price: $977.14Immunogen mitochondrial ribosomal protein L28 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA055589-100UL
Sigma-Aldrich
Anti-MRPL28 antibody produced in rabbit (C15-1462-059)
Price: $928.29List Price: $1,031.43Immunogen mitochondrial ribosomal protein L28 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA047255-100ULImmunogen mitochondrial ribosomal protein L30 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,
-
HPA018331-100UL39S ribosomal protein L39, mitochondrial (MRPL39) was originally named as MRP-L5. Immunogen Mitochondrial 39S ribosomal protein L39 (L39mt) (MRP-L39) (MRP-L5).