Immunology

Immunogen mucin 1 isoform 5 precursor recombinant protein epitope signature tag (PrEST) Sequence AVCQCRRKNYGQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSLSYTNPAVAATSANL Application Anti-MUC1 antibody produced in rabbit, a Prestige Antibody, is

Immunogen MUC12 protein Fragment recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

The gene MUC13 (mucin 13) is mapped to human chromosome 3q21. The gene encodes a transmembrane O -linked glycoprotein.

Mucin-15 (MUC15) is a type-I membrane-bound glycoprotein. The gene encoding it is localized on human chromosome 11p14.

Immunogen mucin 15, cell surface associated Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen mucin 17, cell surface associated recombinant protein epitope signature tag (PrEST) Application Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below. Immunohistochemistry

Immunogen mucin 21, cell surface associated recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Mucin-4 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Immunogen mucin 5AC, oligomeric mucus/gel-forming Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Mucin 5B (MUC5B) gene is mapped to human chromosome 11p15.5.

MUC7 (mucin 7) is the lower molecular weight (200- 300kDa) mucin of the two types of oral cavity mucins, and is also called MG2. The other type of mucin, MG1, has high molecular weight (1000kDa).

Immunogen MUM1-like protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by