-
Add to Cart The item has been addedHPA059197-100ULImmunogen myosin, light chain 9, regulatory Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA059704-100ULSigma-Aldrich
Anti-MYLK2 antibody produced in rabbit (C15-1463-354)
Price: $928.29List Price: $1,031.43Immunogen myosin light chain kinase 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA059890-100ULSigma-Aldrich
Anti-MYLK2 antibody produced in rabbit (C15-1463-402)
Price: $928.29List Price: $1,031.43Immunogen myosin light chain kinase 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA015860-100ULImmunogen Myosin light chain kinase family member 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA024223-100ULThe gene MYO10 (unconventional myosin-10) is mapped to human chromosome 5p15.1. -
Add to Cart The item has been addedHPA078501-100ULImmunogen Recombinant protein corresponding to myosin XVA Sequence LHPHLTRFLQDVSRTPGLPFQGIAKACEQNLQKTLRFGGRLELPSSIELRAMLAGRSSKRQLFLLPGGLERHLKIKTCTVALDVVEEICAEMA Application All Prestige Antibodies Powered by Atlas Antibodies are developed and -
Add to Cart The item has been addedHPA040110-100ULSigma-Aldrich
Anti-MYO16 antibody produced in rabbit (C15-1456-068)
Price: $928.29List Price: $1,031.43Immunogen myosin XVI recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA058769-100ULSigma-Aldrich
Anti-MYO16 antibody produced in rabbit (C15-1463-047)
Price: $928.29List Price: $1,031.43Immunogen myosin XVI Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
Add to Cart The item has been addedHPA071948-100ULSigma-Aldrich
Anti-MYO16 antibody produced in rabbit (C15-1466-141)
Price: $928.29List Price: $1,031.43Immunogen myosin XVI Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
Add to Cart The item has been addedHPA000953-100ULImmunogen Myosin-XVIIIb recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the -
Add to Cart The item has been addedHPA059715-100ULImmunogen myosin XIX Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
Add to Cart The item has been addedHPA053490-100ULImmunogen myosin IA Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The
