Immunology

Immunogen Myomesin-2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen Myomesin-2 recombinant protein epitope signature tag (PrEST) Sequence ERLMALSNEIKNPTIPLKSELAYEIFDKGRVRFWLQAEHLSPDASYRFIINDREVSDSEIHRIKCDKATGIIEMVMDRFSIENEGTYTVQIHDGKAKSQSSLVLIGDAFKTVLEEAEFQRKEFLRKQGPHFAEYLHWDVT Application All Prestige

Immunogen myomesin family, member 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen myomesin 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen myomesin family, member 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Specificity Myosin, human, smooth and non-muscle regulatory light chain, phosphoSer19. By Western blot the antibody recognizes the ~20 kDa phosphorylated protein.

Myosins are a superfamily of molecular motor proteins found in eukaryotic cells. Motor proteins are involved in muscular contraction, cytokinesis, short-range membrane/vesicle transport and a host of other cellular processes.

Myosin XIX (Myo19) is the founding member of a novel class of myosin that associates with mitochondria. Both endogenous Myo19 and GFP-Myo19 exihibit localization to mitochondria.

Myosin-10 (UniProt P35580 also known as Cellular myosin heavy chain, type B, Myosin heavy chain 10, Myosin heavy chain, non-muscle IIb, NMMHC-B, NMMHC II-b, NMMHC-IIB, Non-muscle myosin heavy chain B, Non-muscle myosin heavy chain IIb) is encoded

Myosin-VI has been found in the membrane ruffles at the leading edge of the Golgi complex. Myosin-VI moves along the actin in the opposite way of other known myosins to date, toward the minus end.

Immunogen myozenin 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen myozenin 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most