-
HPA039883-100ULNeural precursor cell expressed, developmentally down-regulated 4, E3 ubiquitin protein ligase (NEDD4) has an amino terminal domain, four tryptophan-rich WW domains and a carboxy-terminal homologous to the E6-AP carboxyl terminus (HECT) ubiquitin
-
HPA020873-100UL
Sigma-Aldrich
Anti-NEK1 antibody produced in rabbit (C15-1449-683)
Price: $879.43List Price: $977.14The gene NEK1 (never in mitosis A-related kinase 1) is mapped to human chromosome 4q33. The protein localizes in the cytoplasm and mitochondria. -
HPA040413-100UL
Sigma-Aldrich
Anti-NEK1 antibody produced in rabbit (C15-1456-191)
Price: $928.29List Price: $1,031.43Immunogen NIMA (never in mitosis gene a)-related kinase 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as -
HPA038941-100ULThe gene NEK10 (NIMA related kinase 10) is mapped to human chromosome 3p24. The encoded protein belongs to the NEK kinase family of proteins.
-
HPA016908-100ULNEK11 (NIMA-related kinase 11) is a checkpoint-associated protein kinase belonging to the NIMA (never in mitosis gene A) family. It is localized at the nucleoli.
-
HPA064967-100ULImmunogen NIMA-related kinase 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
-
HPA019062-100UL
Sigma-Aldrich
Anti-NEK3 antibody produced in rabbit (C15-1449-195)
Price: $879.43List Price: $977.14The gene NEK3 (never in mitosis A-related kinase 3) is mapped to human chromosome 13q14.13. -
HPA043230-100UL
Sigma-Aldrich
Anti-NEK3 antibody produced in rabbit (C15-1457-582)
Price: $928.29List Price: $1,031.43Immunogen NIMA (never in mitosis gene a)-related kinase 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as -
HPA015750-100UL
Sigma-Aldrich
Anti-NEK4 antibody produced in rabbit (C15-1448-440)
Price: $879.43List Price: $977.14Immunogen Serine/threonine-protein kinase Nek4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA058543-100UL
Sigma-Aldrich
Anti-NEK4 antibody produced in rabbit (C15-1462-981)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to NIMA related kinase 4 Sequence YGEGKGQTNEINALVQLMTQTLKLDSKESCEDVPVANPVSEFKLHRKYRDTLILHGKVAEEAEEIHFKELPSAIMPGSEKIRRLVEVLRTDVIRG Application All Prestige Antibodies Powered by Atlas Antibodies are -
HPA035565-100UL
Sigma-Aldrich
Anti-NEK5 antibody produced in rabbit (C15-1453-913)
Price: $928.29List Price: $1,031.43Immunogen NIMA (never in mitosis gene a)-related kinase 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as -
HPA041399-100UL
Sigma-Aldrich
Anti-NEK5 antibody produced in rabbit (C15-1456-676)
Price: $928.29List Price: $1,031.43Immunogen NIMA-related kinase 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the