-
HPA028852-100UL
Sigma-Aldrich
Anti-PACSIN1 antibody produced in rabbit (C15-1452-026)
Price: $879.43List Price: $977.14Immunogen protein kinase C and casein kinase substrate in neurons 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
HPA055491-100UL
Sigma-Aldrich
Anti-PACSIN1 antibody produced in rabbit (C15-1462-036)
Price: $928.29List Price: $1,031.43Immunogen protein kinase C and casein kinase substrate in neurons 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
AV52328-100UL
Sigma-Aldrich
Anti-PADI2 antibody produced in rabbit (C15-1341-844)
Price: $898.29List Price: $998.10PADI2 encodes a member of the peptidyl arginine deiminase family of enzymes, which catalyze the post-translational deimination of proteins by converting arginine residues into citrullines in the presence of calcium ions. The family members have -
HPA030809-100UL
Sigma-Aldrich
Anti-PADI2 antibody produced in rabbit (C15-1452-851)
Price: $879.43List Price: $977.14Immunogen Protein-arginine deiminase, type-6 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA047735-100UL
Sigma-Aldrich
Anti-PADI2 antibody produced in rabbit (C15-1459-318)
Price: $928.29List Price: $1,031.43Immunogen peptidyl arginine deiminase, type II Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA001632-100ULImmunogen phosphoprotein membrane anchor with glycosphingolipid microdomains 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by
-
HPA003473-100ULImmunogen G antigen family B member 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
-
HPA052619-100ULImmunogen P antigen family, member 2B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
-
HPA062248-100ULImmunogen P antigen family, member 3 (prostate associated) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
-
AV40651-100UL
Sigma-Aldrich
Anti-PAIP1 antibody produced in rabbit (C15-1341-263)
Price: $759.43List Price: $843.81Immunogen Synthetic peptide directed towards the C terminal region of human PAIP1 Biochem/physiol Actions PAIP1 interacts with poly(A)-binding protein and with the cap-binding complex eIF4A. It is involved in translational initiation and protein -
HPA073653-100UL
Sigma-Aldrich
Anti-PAIP1 antibody produced in rabbit (C15-1466-417)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to poly(A) binding protein interacting protein 1 Sequence GTNGQVTRADILQVGLRELLNALFSNPMDDNLICAVKLLKLTGSVLEDAWKEKGKMDMEEIIQRIENVVLDANCSRDVKQMLLK Application All Prestige Antibodies Powered by Atlas -
HPA076187-100UL
Sigma-Aldrich
Anti-PAIP1 antibody produced in rabbit (C15-1466-847)
Price: $928.29List Price: $1,031.43Immunogen poly(A) binding protein interacting protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive