-
Add to Cart The item has been addedHPA003239-100ULPCMT1 (protein-L-isoaspartate (D-aspartate) O -methyltransferase) gene encodes a protein that belongs to type II class of protein carboxyl methyltransferase enzymes. This gene is mapped to human chromosome 6q24-25. -
Add to Cart The item has been addedHPA025696-100ULSigma-Aldrich
Anti-PCMTD1 antibody produced in rabbit (C15-1450-956)
Price: $879.43List Price: $977.14The gene PCMTD1 (protein-L-isoaspartate (D-aspartate) O -methyltransferase domain containing 1) is mapped to human chromosome 8q. Single nucleotide polymorphism at rs1015213, which is present in the intergenic region between PCMTD1 and ST18 -
Add to Cart The item has been addedHPA061444-100ULSigma-Aldrich
Anti-PCMTD1 antibody produced in rabbit (C15-1463-799)
Price: $928.29List Price: $1,031.43Immunogen protein-L-isoaspartate (D-aspartate) O-methyltransferase domain containing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA057849-100ULImmunogen protein-L-isoaspartate (D-aspartate) O-methyltransferase domain containing 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA016820-100ULSigma-Aldrich
Anti-PCNT antibody produced in rabbit (C15-1448-605)
Price: $977.14List Price: $1,085.71PCNT (pericentrin) is a centrosomal protein mapped on chromosome 21q22.3. -
Add to Cart The item has been addedHPA019887-100ULSigma-Aldrich
Anti-PCNT antibody produced in rabbit (C15-1449-470)
Price: $879.43List Price: $977.14PCNT (pericentrin) is a centrosomal protein mapped on chromosome 21q22.3. -
Add to Cart The item has been addedHPA053532-100ULImmunogen pecanex homolog 1 (Drosophila) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA013815-100ULSigma-Aldrich
Anti-PCNX2 antibody produced in rabbit (C15-1448-025)
Price: $879.43List Price: $977.14PCNXL2 (Pecanex-like protein 2) gene encodes a multi-transmembrane protein whose function is yet to be characterized. Immunogen pecanex homolog 2 (Drosophila) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies -
Add to Cart The item has been addedHPA014427-100ULSigma-Aldrich
Anti-PCNX2 antibody produced in rabbit (C15-1448-134)
Price: $879.43List Price: $977.14Immunogen pecanex homolog 2 (Drosophila) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA018084-100ULThe gene encoding pecanex-like protein 3 (PCNXL3) is located on human chromosome 11q13.1. -
Add to Cart The item has been addedHPA002076-100ULSigma-Aldrich
Anti-PCNX4 antibody produced in rabbit (C15-1445-519)
Price: $879.43List Price: $977.14Immunogen pecanex homolog 4 (Drosophila) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA003390-100ULSigma-Aldrich
Anti-PCNX4 antibody produced in rabbit (C15-1445-933)
Price: $879.43List Price: $977.14Immunogen Pecanex homolog 4 (Drosophila) recombinant protein epitope signature tag (PrEST) Sequence NKSTTVERILTTDILAEEDEHEFTSCTGAETVKFLIPGKKYV Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human
