Immunology

Immunogen PDZ domain-containing protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

PDZK1IP1 (PDZK1 interacting protein 1) is a non-glycosylated membrane protein, which resides in the plasma membrane and Golgi bodies. It has a hydrophobic N-terminal of 13 residues, making the PDZ-binding domain, and two transmembrane regions.

Immunogen PDZ domain containing ring finger 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen PDZ domain containing ring finger 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Pseudopodium enriched atypical kinase 1 (PEAK1) is a non-receptor tyrosine kinase which is part of the new kinase family three (NKF3). It is expressed in many tissues.

Pseudopodium enriched atypical kinase 1 (PEAK1) is a non-receptor tyrosine kinase which is part of the new kinase family three (NKF3). It is expressed in many tissues.

PEBP1 is a phosphatidylethanolamine binding protein that interacts with nucleotides and Raf-1 peptides. Studies in rat have revealed that PEBP1 is downregulated during hypoxia.

PEBP1 (phosphatidylethanolamine binding protein 1), also called Raf kinase inhibitory protein (RKIP), is a member of the PEBP class of proteins. This class was initially identified as the class of proteins specifically interacting with

Immunogen Recombinant protein corresponding to phosphatidylethanolamine binding protein 1 Sequence MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTP Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human

CD31, also known as platelet endothelial cell adhesion molecule 1 (PECAM1) is a type I integral membrane glycoprotein, and a member of the immunoglobulin superfamily of cell surface receptors. PECAM-1 is constitutively expressed on the surface of

Platelet endothelial cell adhesion molecule (UniProt Q08481 also known as CD31, PECAM-1) is encoded by the Pecam1 (also known as Pecam, Pecam-1) gene (Gene ID 18613) in murine species. PECAM-1 (CD31) is a 130-kD cell adhesion molecule that is

PECAM-1 is a type I integral membrane glycoprotein, and a member of the immunoglobulin superfamily of cell surface receptors. PECAM-1 is constitutively expressed on the surface of endothelial cells where it is concentrated at cell junctions.