-
Add to Cart The item has been addedHPA039874-100ULImmunogen prohibitin 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA006973-100ULImmunogen Putative uncharacterized protein DKFZp686A1782 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA047403-100ULImmunogen polyhomeotic homolog 2 (Drosophila) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedHPA039162-100ULSigma-Aldrich
Anti-PHC3 antibody produced in rabbit (C15-1455-603)
Price: $928.29List Price: $1,031.43Immunogen polyhomeotic homolog 3 (Drosophila) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedHPA062031-100ULSigma-Aldrich
Anti-PHC3 antibody produced in rabbit (C15-1463-973)
Price: $928.29List Price: $1,031.43Immunogen polyhomeotic homolog 3 (Drosophila) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedAV39588-100ULPHF1 is a PHD finger protein that regulates p53-dependent cell growth arrest and apoptosis. The Tudor domain of PHF1 is known to interact with histone H3K36me3. -
Add to Cart The item has been addedHPA016566-100ULImmunogen PHD finger protein 11 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA021410-100ULSigma-Aldrich
Anti-PHF12 antibody produced in rabbit (C15-1449-856)
Price: $879.43List Price: $977.14The gene PHF12 (PHD finger protein 12) is mapped to human chromosome 17q11.2. -
Add to Cart The item has been addedHPA021452-100ULSigma-Aldrich
Anti-PHF12 antibody produced in rabbit (C15-1449-870)
Price: $879.43List Price: $977.14Immunogen PHD finger protein 12 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA000538-100ULSigma-Aldrich
Anti-PHF14 antibody produced in rabbit (C15-1444-973)
Price: $879.43List Price: $977.14Immunogen PHD finger protein 14 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
Add to Cart The item has been addedHPA017376-100ULSigma-Aldrich
Anti-PHF14 antibody produced in rabbit (C15-1448-759)
Price: $879.43List Price: $977.14Immunogen Recombinant protein corresponding to PHD finger protein 14 Sequence TRMPRKTKNSYWQCSECDQAGSSDMEADMAMETLPDGTKRSRRQIKEPVKFVPQDVPPEPKKIPIRNTRTRGRKRSFVPEEEKHEERVPRERRQRQSVLQKKPKAEDLR Application All Prestige Antibodies Powered by Atlas -
Add to Cart The item has been addedAV34760-100ULPHF17 (PHD finger protein 17) is a short-lived, kidney-enriched Jade protein consisting of canonical plant homeodomain (PHD) finger protein and a non-canonical extended PHD with zinc-binding ability. It is localized in the nucleus and is highly
