Immunology

Paired mesoderm homeobox protein 2B (PHOX2B), also known as Neuroblastoma Phox (NBPhox), PHOX2B homeodomain protein, and Paired-like homeobox 2B is a paired-homeodomain transcription factor that maintains the noradrenergic phenotype during

Immunogen paired-like homeobox 2b Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Recombinant protein corresponding to paired like homeobox 2b Sequence MEYSYLNSSAYESCMAGMDTSSLASAYADFSSCSQASGFQYNPIRTTFGATSGCPSLTPGSCSLGTLRDHQS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by

PHRF1 (PHD and ring finger domains 1) is a TGIF ubiquitin ligase consisting of an N-terminal PHD/bromodomain, a RING finger domain and a large domain of unique sequence at the C-terminal end. Immunogen PHD and RING finger domain-containing protein

Immunogen PHD and ring finger domains 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen protease inhibitor 15 preproprotein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

PI15 (peptidase inhibitor 15) is a trypsin-binding protein with a molecular weight of 25 kDa. It is expressed in the brain, placenta and lymphocytes, including neuroblastoma and glioblastoma cell lines.

Immunogen peptidase inhibitor 16 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen Recombinant protein corresponding to peptidase inhibitor 16 Sequence TGARELLPHAQEEAEAEAELPPSSEVLASVFPAQDKPGELQATLDHTGHTSSKSLPNFPNTSATANATGG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the

Immunogen Phosphatidylinositol 4-kinase type 2-beta recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen Phosphatidylinositol 4-kinase &#946 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen Phosphatidylinositol 4-kinase &#946 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,