Immunology

Rabbit anti Human ATP6V1B1 Antibody, Polyclonal, could be used for WB, IHC, ICC, IF and so on.Application:WB: 1/1000:IHC: 1/100-1/500:ICC/IF: 1/10-1/50:Protein Function:Non-catalytic subunit of the peripheral V1 complex of vacuolar ATPase. V-ATPase

Rabbit anti Human ATP6V1B1 Antibody, Polyclonal, could be used for WB, IHC, ICC, IF and so on.Application:WB: 1/1000:IHC: 1/100-1/500:ICC/IF: 1/10-1/50:Protein Function:Non-catalytic subunit of the peripheral V1 complex of vacuolar ATPase. V-ATPase

Immunogen ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

ATP6V1C1 (ATPase H + transporting V1 subunit C1) is a subunit and regulator of V-ATPase (vacuolar ATPase). Immunogen V-type proton ATPase subunit C 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by

Immunogen ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen Recombinant protein corresponding to ATPase H+ transporting V1 subunit C2 Sequence YPVKQPLVSVVDTIAKQLAQIEMDLKSRTAAYNTLKTNLENLEKKSMGNLFTRTLSDIVSKED Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated

Copper-transporting ATPase 1 (ATP7A) is a P-type ATPase localized in the trans-Golgi network (TGN). It has an amino-terminal region with six metal binding motifs, eight transmembrane domains and several other residues or motifs generally present in

Immunogen ATPase, Cu++ transporting, alpha polypeptide Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen ATPase, Cu++ transporting, beta polypeptide Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

ATP7B (ATPase, Cu ++ transporting, &#946 polypeptide) gene is mapped to human chromosome 13. It is expressed predominantly in liver, kidney, and placenta in humans.

Immunogen ATPase, aminophospholipid transporter (APLT), class I, type 8A, member 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Immunogen ATPase, aminophospholipid transporter, class I, type 8A, member 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas