Immunology

B2M (&#946-2-microglobulin) is the invariant light chain of the HLA antigen protein. It is low molecular weight protein.

Immunogen Synthetic peptide directed towards the N terminal region of human B3GALT6 Application Anti-B3GALT6 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1.0&#956g/ml.

Immunogen UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 9 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 9 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

The gene B3GNTL1 (UDP-GlcNAc:&#946Gal &#946-1,3-N-acetylglucosaminyltransferase-like 1) is mapped to human chromosome 17q25.3.

The gene B3GNTL1 (UDP-GlcNAc:&#946Gal &#946-1,3-N-acetylglucosaminyltransferase-like 1) is mapped to human chromosome 17q25.3.

Immunogen Synthetic peptide directed towards the N terminal region of human B4GALNT1 Sequence Synthetic peptide located within the following region: APWAPPQSPRRPELPDLAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGG Physical form Purified antibody supplied in 1x

B4GALNT1 (&#946-1,4- N -acetyl-galactosaminyl transferase 1) gene localizes to human chromosome 12q, and codes for the enzyme GM synthase. Immunogen &#946-1,4 N-Acetylgalactosaminyltransferase 1 recombinant protein epitope signature tag (PrEST)

B4GALNT1 (&#946-1,4-N-acetyl-galactosaminyl transferase 1) is a GalNAc transferase, and is also called GM2 synthase. This gene is located on human chromosome 12q.

Immunogen Beta-1,4 N-acetylgalactosaminyltransferase 2 recombinant protein epitope signature tag (PrEST) Application Anti-B4GALNT2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project

Immunogen beta-1,4-N-acetyl-galactosaminyltransferase 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

B4GALT1 (UDP-Gal:&#946GlcNAc &#946 1,4- galactosyltransferase, polypeptide 1) belongs to a family of type II transmembrane proteins called glycosyltransferases, which resides in Golgi apparatus. This family consists of seven members, from GALT1