Immunology

Immunogen BAH domain and coiled-coil containing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Recombinant protein corresponding to BAH domain and coiled-coil containing 1 Sequence SGLDKSGYFELPTSSQDCARPGHQDPLGGKAPQACCTLDKTVGKEAPAGPPGAQKVARIRHQQHLMAAEVEQGGIGAEAKRKSLELA Application All Prestige Antibodies Powered by Atlas Antibodies

Bak or Bcl2 homologous antagonist is a member of the Bcl2 family of proteins. The Bcl-2 related proteins interact with one another through the formation of homo and heterodimers.

Bak (Bcl-2 homologous antagonist/killer, Bak1) belongs to the B-cell lymphoma 2 (Bcl-2) family of proteins. The bak gene is mapped to chromosome 6 and encodes a 233 amino acid protein with a predicted MW of 23.

Bone morphogenic protein and activin membrane-bound inhibitor (BAMBI) is a transmembrane glycoprotein which is a pseudo receptor belonging to the family of TGF-&#946 (transforming growth factor beta receptor) type I receptors. BAMBI is

BAMBI (bone morphogenetic protein and activin membrane-bound inhibitor) is a pseudoreceptor of TGF-&#946, and is highly conserved in vertebrates. This protein is a transmembrane glycoprotein and shows homology with TGF-&#946 type I receptors.

Immunogen barrier to autointegration factor 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen B-cell scaffold protein with ankyrin repeats 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen BTG3 associated nuclear protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen BRCA1 associated RING domain 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen BRCA1 associated RING domain 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen BARX homeobox 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.