-
Add to Cart The item has been addedA2856-200ULANTI-ATG7 ANTIBODY PRODUCED IN RABBIT AFFINITY ISOLATED ANTIBODY (C005B-238876)
Price: $1,205.29List Price: $1,339.21Autophagy is a catabolic process by which cell delivers cytoplasmic constituent into lysosome for protein degradation. 16 ATG genes are essential for autophagosome preparation out of which Atg7 is the one required to activate ubiquitin-like -
Add to Cart The item has been addedHPA059551-100ULANTI-ATG9A ANTIBODY PRODUCED IN RABBIT
Price: $1,210.58List Price: $1,345.09Immunogen autophagy related 9A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been added600-401-Y88Anti-ATG9A (RABBIT) Antibody, 100 g, Liquid (sterile filtered)
Price: $1,662.41List Price: $1,847.13Anti-ATG9A Antibody has been tested for use in ELISA, Western Blotting, Immunohistochemistry and Immunofluorescence. Specific conditions for reactivity should be optimized by the end user. -
Add to Cart The item has been added600-401-Y89Anti-ATG9B (RABBIT) Antibody, 100 g, Liquid (sterile filtered)
Price: $1,662.41List Price: $1,847.13Anti-ATG9B Antibody has been tested for use in ELISA, Western Blotting, Immunocytochemistry and Immunofluorescence. Specific conditions for reactivity should be optimized by the end user. -
Add to Cart The item has been addedAB5692ANTI-ATH 1 ANTIBODY (C005B-240162)
Price: $1,040.03List Price: $1,155.59Specificity Recognizes ATH 1 (MATH1) (NeuroD Family), a Helix-loop-helix class of transcription factor. Immunogen Synthetic peptide, amino acids 188-200 of human ATH1. -
Add to Cart The item has been addedHPA075302-100ULANTI-ATL2 (C005B-221924)
Price: $1,210.58List Price: $1,345.09Immunogen Recombinant protein corresponding to atlastin GTPase 2 Sequence RTSDPSAAVNHVSSTTSLGENYEDDDLVNSDEVMKKPCPVQIVLAHEDDHNFELDEEALEQ Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein -
Add to Cart The item has been addedHPA067142-100ULANTI-ATM (C005B-220479)
Price: $1,039.98List Price: $1,155.53Immunogen ATM serine/threonine kinase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been added05-513ANTI-ATM ANTIBODY CLONE AM9
Price: $747.24List Price: $830.27Specificity ATM Immunogen Full-length human ATM Application Detect ATM also known as Ataxia Telangiectasia Mutated with Anti-ATM Antibody, clone AM9 (Mouse Monoclonal Antibody), that has been demonstrated to work in WB. Research Category -
Add to Cart The item has been added200-303-400Anti-ATM Protein Kinase pS1981 (MOUSE) Monoclonal Antibody Peroxidase Conjugated, 100 g, Lyophilized
Price: $1,913.79List Price: $2,126.43This product has been tested by ELISA, IF, and western blotting against both the native and recombinant forms of the protein. This reagent may also be suitable for immunoperoxidase electron microscopy and immunohistochemistry as well as other -
Add to Cart The item has been added600-601-400SAnti-ATM Protein Kinase pS1981 (SHEEP) Antibody, 25 L, Liquid (sterile filtered)
Price: $399.48List Price: $443.86Affinity purified sheep anti-ATM has been tested by ELISA and western blotting against native form phosphorylated ATM PK. -
Add to Cart The item has been added600-401-398Anti-ATM Protein Kinase S1981 (RABBIT) Antibody, 100 g, Liquid (sterile filtered)
Price: $1,662.41List Price: $1,847.13Affinity purified rabbit anti-ATM has been tested by ELISA, immunohistochemistry, western blotting and biological assays against both the native and recombinant forms of the protein. -
Add to Cart The item has been addedHPA066900-100ULANTI-ATMIN ANTIBODY PRODUCED IN RABBIT (C005B-220423)
Price: $1,210.58List Price: $1,345.09Immunogen ATM interactor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The
Immunological testing systems and components
Browse our curated selection of Immunological testing systems and components from leading global manufacturers. Find research-grade reagents, certified standards, and specialty supplies backed by Cenmed's expert sourcing and technical support.
Related Categories
About Immunological testing systems and components
Cenmed Enterprises provides a comprehensive selection of Immunological testing systems and components products sourced from leading global manufacturers. Our catalog spans research-grade reagents, certified standards, and specialty compounds used across clinical, academic, and industrial laboratories worldwide.
With decades of expertise in laboratory supply distribution, we offer competitive pricing, reliable stock availability, and dedicated technical support. Whether you need small quantities for research or bulk orders for manufacturing, our team is ready to assist with sourcing, compliance documentation, and logistics.