Immunological testing systems and components

Immunogen choline dehydrogenase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Chromogranin A (CHGA) or CgA is a neuro-secretory protein, and is a member of the granin family. This protein is usually found within chromaffin granules in the adrenal medulla and released along with the catecholamines.

Immunogen Chromogranin b Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen Recombinant protein corresponding to cysteine rich hydrophobic domain 2 Sequence DFDEIYEEEEDEERALEEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASINRVNSCLKKNLPVNVR Application All Prestige Antibodies Powered by Atlas Antibodies are

Immunogen Recombinant protein corresponding to cysteine rich hydrophobic domain 2 Sequence MADFDEIYEEEEDEERALEEQLLKYSPDPVVVRGSGHVTVFGLS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

General description Anti-Chicken egg albumin (ovalbumin) antibody, Mouse monoclonal, (mouse IgG1 isotype) is derived from the hybridoma OVA-14 produced by the fusion of mouse myeloma cells and splenocytes from BALB/c mice immunized with purified

Chicken/hen&#8242s egg albumin, also known as ovalbumin (OVA), is the most abundant egg white protein. It is surrounded by B-cell epitopes, which are bound by specific IgE antibodies.

Specificity This product was prepared from monospecific antiserum by immunoaffinity chromatography using Chicken IgG coupled to agarose beads followed by solid phase adsorption(s) to remove any unwanted reactivities. Assay by immunoelectrophoresis

Specificity This product was prepared from monospecific antiserum by immunoaffinity chromatography using Chicken IgG coupled to agarose beads followed by solid phase adsorption(s) to remove any unwanted reactivities. Assay by immunoelectrophoresis

Specificity This product was prepared from monospecific antiserum by immunoaffinity chromatography using Chicken IgG coupled to agarose beads. Assay by immunoelectrophoresis resulted in a single precipitin arc against Anti-Peroxidase, Anti-Rabbit

Anti-Chicken IgG antibody is suitable for ELISA, Western Blot and Immunohistochemistry applications. Specific conditions for reactivity should be optimized by end user.

Anti-Chicken IgG (H&L) is suitable for use in immunoelectrophoresis, western-blot, competitive western-blot, ELISA and competitive ELISA assays. Specific conditions for reactivity and signal detection should be optimized by the end user.